BS28790.complete Sequence
329 bp assembled on 2012-03-26
GenBank Submission: KX803562
> BS28790.complete
GAAGTTATCAGTCGACATGCCTTCCGTCGAGTGGGTCTGTGGTTTGCTCT
ACTACGTTATGCGCACCTACATAAAGGTATTCGTATCCAGTTGCGAAGCA
CACTTCCCTATCGATATCCTTGACAAGATTGTGTATTTGATAGATTTCGC
CGAAGTTTCCATGAAGATAATGCGCCGGCCAAGAAATTACACGAATCCGA
CTGAGCGCCAAGCGAGACGCCTTCAATTCTACAATTTCCTTTTAAAGTTA
AGATTTTTGGCACAGGTGATCTACACCTTGGTAGCCGTGGTAATTGGGAC
ACTTAAAACATAAAAGCTTTCTAGACCAT
BS28790.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:19:18
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG42766-RB | 297 | CG42766-PB | 1..297 | 17..313 | 1485 | 100 | Plus |
| CG42766-RA | 297 | CG42766-PA | 1..273 | 17..289 | 1365 | 100 | Plus |
| CG43076-RA | 483 | CG43076-PA | 11..273 | 27..289 | 325 | 74.9 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:19:19
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG42766-RB | 732 | CG42766-RB | 111..414 | 12..315 | 1505 | 99.7 | Plus |
| CG42766-RA | 626 | CG42766-RA | 111..388 | 12..289 | 1375 | 99.6 | Plus |
| CG43076-RA | 771 | CG43076-RA | 110..372 | 27..289 | 325 | 74.9 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:19:17
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| X | 23542271 | X | 15977153..15977342 | 126..315 | 950 | 100 | Plus |
| X | 23542271 | X | 15976978..15977093 | 12..127 | 565 | 99.1 | Plus |
| X | 23542271 | X | 15223143..15223286 | 295..152 | 210 | 76.4 | Minus |
Blast to na_te.dros performed on 2014-11-28 04:19:17 has no hits.
BS28790.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:15:04 Download gff for
BS28790.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG42766-RB | 116..403 | 17..304 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:16:30 Download gff for
BS28790.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG42766-RB | 116..403 | 17..304 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:25:33 Download gff for
BS28790.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG42766-RB | 116..403 | 17..304 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:25:33 Download gff for
BS28790.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| X | 15976983..15977093 | 17..127 | 100 | -> | Plus |
| X | 15977155..15977331 | 128..304 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:16:30 Download gff for
BS28790.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_X | 15871016..15871126 | 17..127 | 100 | -> | Plus |
| arm_X | 15871188..15871364 | 128..304 | 100 | | Plus |
BS28790.pep Sequence
Translation from 16 to 312
> BS28790.pep
MPSVEWVCGLLYYVMRTYIKVFVSSCEAHFPIDILDKIVYLIDFAEVSMK
IMRRPRNYTNPTERQARRLQFYNFLLKLRFLAQVIYTLVAVVIGTLKT*
BS28790.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:11:29
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG42766-PB | 98 | CG42766-PB | 1..98 | 1..98 | 504 | 100 | Plus |
| CG42766-PA | 98 | CG42766-PA | 1..92 | 1..92 | 472 | 98.9 | Plus |
| CG43076-PA | 160 | CG43076-PA | 1..92 | 1..92 | 223 | 50 | Plus |
