Clone BS28809 Report

Search the DGRC for BS28809

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:288
Well:9
Vector:pDNR-Dual
Associated Gene/Transcripthalo-RB
Protein status:BS28809.pep: gold
Sequenced Size:362

Clone Sequence Records

BS28809.complete Sequence

362 bp assembled on 2012-04-25

GenBank Submission: KX800202

> BS28809.complete
GAAGTTATCAGTCGACATGGCCGAGCTACTTTTTCCACAACTGGAGCGTC
CTTTGCCCTCGCTGCCATCGCTGCACTACACCCTGTTTGCCTACAGGGAG
GAGTTGCGACGCCGCGATGCCCCGTTCATGAAGATGTCCACCATCAAGCT
GCATCTCACGGACAACCTCATCCTGCAGACGATCAAGAACATCCGGCAGT
ATGACACCATCGAGATTATGAATCTCAACCAGGAGATAAACTTCAAGCGG
CGGCTGACCAAACAAATGAGGAAGGTGCGCAAACTGGAGAAGCTCGGCTT
GCACATCGATCCCCGGAAACTCAACGAGGACGGCAAATGGCACTGAAAGC
TTTCTAGACCAT

BS28809.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 12:24:37
Subject Length Description Subject Range Query Range Score Percent Strand
halo-RB 330 CG7428-PB 1..330 17..346 1650 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:24:38
Subject Length Description Subject Range Query Range Score Percent Strand
halo-RB 616 CG7428-RB 88..418 17..347 1655 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 12:24:34
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1517731..1518061 347..17 1655 100 Minus
Blast to na_te.dros performed on 2014-11-28 12:24:35 has no hits.

BS28809.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-25 15:18:02 Download gff for BS28809.complete
Subject Subject Range Query Range Percent Splice Strand
halo-RA 124..452 17..345 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:42:42 Download gff for BS28809.complete
Subject Subject Range Query Range Percent Splice Strand
halo-RB 88..416 17..345 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:03:31 Download gff for BS28809.complete
Subject Subject Range Query Range Percent Splice Strand
halo-RB 88..416 17..345 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 13:03:31 Download gff for BS28809.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1517733..1518061 17..345 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:42:42 Download gff for BS28809.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1517733..1518061 17..345 100   Minus

BS28809.pep Sequence

Translation from 16 to 345

> BS28809.pep
MAELLFPQLERPLPSLPSLHYTLFAYREELRRRDAPFMKMSTIKLHLTDN
LILQTIKNIRQYDTIEIMNLNQEINFKRRLTKQMRKVRKLEKLGLHIDPR
KLNEDGKWH*

BS28809.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:24:14
Subject Length Description Subject Range Query Range Score Percent Strand
halo-PB 109 CG7428-PB 1..109 1..109 565 100 Plus
CG13711-PA 127 CG13711-PA 37..115 17..95 165 32.9 Plus
CG13713-PA 99 CG13713-PA 9..81 17..89 143 37 Plus
CG13716-PA 117 CG13716-PA 24..94 14..84 135 40.8 Plus