BS28820.complete Sequence
230 bp assembled on 2012-03-26
GenBank Submission: KX802567
> BS28820.complete
GAAGTTATCAGTCGACATGTCGTTGGGCAACGCAGGGCGAATCGCTGTCT
GTTGGACTGTTTTGACCGTGGGTGGCGTCTACGCATTTGTGCTGTCAAAG
AGATCCGTTGAGAACCGGCGTTACGAGAGCATGCGAGTGCGTGAGCGCAT
GAGGAAGGCAAACCAAGGGGATTACGACTCAAGCGCAGCATCGGACAGGC
GATTCGATTACTAAAAGCTTTCTAGACCAT
BS28820.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:19:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42497-RA | 198 | CG42497-PA | 1..198 | 17..214 | 990 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:19:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Tim10-RA | 691 | CG9878-RA | 31..228 | 17..214 | 990 | 100 | Plus |
CG42497-RA | 691 | CG42497-RA | 31..228 | 17..214 | 990 | 100 | Plus |
Tim10-RB | 762 | CG9878-RB | 139..299 | 54..214 | 805 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:19:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 21690841..21691001 | 214..54 | 805 | 100 | Minus |
2R | 25286936 | 2R | 21691071..21691109 | 55..17 | 195 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 04:19:24 has no hits.
BS28820.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:15:05 Download gff for
BS28820.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Tim10-RA | 30..225 | 17..212 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:16:35 Download gff for
BS28820.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42497-RA | 31..226 | 17..212 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:25:36 Download gff for
BS28820.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42497-RA | 31..226 | 17..212 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:25:36 Download gff for
BS28820.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 21690843..21691000 | 55..212 | 100 | <- | Minus |
2R | 21691072..21691109 | 17..54 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:16:35 Download gff for
BS28820.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 17578348..17578505 | 55..212 | 100 | <- | Minus |
arm_2R | 17578577..17578614 | 17..54 | 100 | | Minus |
BS28820.pep Sequence
Translation from 16 to 213
> BS28820.pep
MSLGNAGRIAVCWTVLTVGGVYAFVLSKRSVENRRYESMRVRERMRKANQ
GDYDSSAASDRRFDY*
BS28820.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:11:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42497-PA | 65 | CG42497-PA | 1..65 | 1..65 | 333 | 100 | Plus |