Clone BS28820 Report

Search the DGRC for BS28820

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:288
Well:20
Vector:pDNR-Dual
Associated Gene/TranscriptCG42497-RA
Protein status:BS28820.pep: full length peptide match
Sequenced Size:230

Clone Sequence Records

BS28820.complete Sequence

230 bp assembled on 2012-03-26

GenBank Submission: KX802567

> BS28820.complete
GAAGTTATCAGTCGACATGTCGTTGGGCAACGCAGGGCGAATCGCTGTCT
GTTGGACTGTTTTGACCGTGGGTGGCGTCTACGCATTTGTGCTGTCAAAG
AGATCCGTTGAGAACCGGCGTTACGAGAGCATGCGAGTGCGTGAGCGCAT
GAGGAAGGCAAACCAAGGGGATTACGACTCAAGCGCAGCATCGGACAGGC
GATTCGATTACTAAAAGCTTTCTAGACCAT

BS28820.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:19:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG42497-RA 198 CG42497-PA 1..198 17..214 990 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:19:25
Subject Length Description Subject Range Query Range Score Percent Strand
Tim10-RA 691 CG9878-RA 31..228 17..214 990 100 Plus
CG42497-RA 691 CG42497-RA 31..228 17..214 990 100 Plus
Tim10-RB 762 CG9878-RB 139..299 54..214 805 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:19:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21690841..21691001 214..54 805 100 Minus
2R 25286936 2R 21691071..21691109 55..17 195 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:19:24 has no hits.

BS28820.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:15:05 Download gff for BS28820.complete
Subject Subject Range Query Range Percent Splice Strand
Tim10-RA 30..225 17..212 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:16:35 Download gff for BS28820.complete
Subject Subject Range Query Range Percent Splice Strand
CG42497-RA 31..226 17..212 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:25:36 Download gff for BS28820.complete
Subject Subject Range Query Range Percent Splice Strand
CG42497-RA 31..226 17..212 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:25:36 Download gff for BS28820.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21690843..21691000 55..212 100 <- Minus
2R 21691072..21691109 17..54 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:16:35 Download gff for BS28820.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17578348..17578505 55..212 100 <- Minus
arm_2R 17578577..17578614 17..54 100   Minus

BS28820.pep Sequence

Translation from 16 to 213

> BS28820.pep
MSLGNAGRIAVCWTVLTVGGVYAFVLSKRSVENRRYESMRVRERMRKANQ
GDYDSSAASDRRFDY*

BS28820.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:11:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG42497-PA 65 CG42497-PA 1..65 1..65 333 100 Plus