Clone BS28856 Report

Search the DGRC for BS28856

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:288
Well:56
Vector:pDNR-Dual
Associated Gene/TranscriptCG33493-RA
Protein status:BS28856.pep: gold
Sequenced Size:341

Clone Sequence Records

BS28856.complete Sequence

341 bp assembled on 2012-03-26

GenBank Submission: KX805942

> BS28856.complete
GAAGTTATCAGTCGACATGCGTGCGCTTCAGTACCTTCTGCTACTGCTCG
TCATCTCCATCGGCTTGGCGGCATCGGTGCCTCGCCAGCGTCGTCAGATC
GATCTCACGGTTTCGGCGGAGCACGACGACAACGATGAGGAGACGGAACT
GGCTCTGGAGGCCATCGCCGGGCTATGGAGCAGTGCGGACAGTCGGACGA
AGATCGATGGCTCTGCCAGCCTGGTGCATCGAACACATGGAACACAATCG
GGTACGGGCAGCACCAGATACCAGGCCAAACTGCATCTACACCATGACTA
TAAGACCAATGCGTATCCCTCGTAAAAGCTTTCTAGACCAT

BS28856.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:19:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG33493-RA 309 CG33493-PA 1..309 17..325 1545 100 Plus
CG33493-RB 285 CG33493-PB 1..241 17..257 1190 99.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:19:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG33493-RA 592 CG33493-RA 43..353 15..325 1555 100 Plus
CG33493-RB 558 CG33493-RB 43..285 15..257 1200 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:19:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 10692815..10693125 325..15 1555 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:19:35 has no hits.

BS28856.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:15:07 Download gff for BS28856.complete
Subject Subject Range Query Range Percent Splice Strand
CG33493-RA 13..319 17..323 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:16:40 Download gff for BS28856.complete
Subject Subject Range Query Range Percent Splice Strand
CG33493-RA 45..351 17..323 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:25:41 Download gff for BS28856.complete
Subject Subject Range Query Range Percent Splice Strand
CG33493-RA 45..351 17..323 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:25:41 Download gff for BS28856.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10692817..10693123 17..323 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:16:40 Download gff for BS28856.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 10685917..10686223 17..323 100   Minus

BS28856.pep Sequence

Translation from 16 to 324

> BS28856.pep
MRALQYLLLLLVISIGLAASVPRQRRQIDLTVSAEHDDNDEETELALEAI
AGLWSSADSRTKIDGSASLVHRTHGTQSGTGSTRYQAKLHLHHDYKTNAY
PS*

BS28856.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:11:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG33493-PA 102 CG33493-PA 1..102 1..102 516 100 Plus
CG33493-PB 94 CG33493-PB 1..80 1..80 388 98.8 Plus