BS28873.complete Sequence
326 bp assembled on 2012-03-26
GenBank Submission: KX801023
> BS28873.complete
GAAGTTATCAGTCGACATGAACTCGCTCATTGTAATTTTTGGATTTCTTT
TTATCTCAACTCAGATAGTCGCAACAACCGAGTCGGAATGTCCTGAAATC
TGTCTTGCAATTTACAGTCCGGTCTGTGAAGAAGCTATGATAAATGGAAA
ATTGGTTAGATGCTTATTCAGTAATAGCTGCGAAGCAGGTCGTAGCGCAT
GTCTTCATGAAATAAATTGGCGCCAAAAAGAAGGAAAATGTGAAACTTCA
CCCGACCACTTATGCCGTCAATACCTTTCATCTAAAAATATTACTTCAAA
AGTAAGCTAAAAGCTTTCTAGACCAT
BS28873.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:19:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42798-RA | 294 | CG42798-PA | 1..294 | 17..310 | 1470 | 100 | Plus |
CG42798-RB | 174 | CG42798-PB | 1..174 | 137..310 | 870 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:19:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42798-RA | 500 | CG42798-RA | 18..311 | 17..310 | 1470 | 100 | Plus |
CG42798-RB | 527 | CG42798-RB | 92..338 | 64..310 | 1235 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:19:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 17407001..17407199 | 17..215 | 995 | 100 | Plus |
3R | 32079331 | 3R | 17407251..17407345 | 216..310 | 475 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 04:19:41 has no hits.
BS28873.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:15:08 Download gff for
BS28873.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42798-RA | 18..309 | 17..308 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:16:44 Download gff for
BS28873.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42798-RA | 18..309 | 17..308 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:25:43 Download gff for
BS28873.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42798-RA | 18..309 | 17..308 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:25:43 Download gff for
BS28873.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17407001..17407199 | 17..215 | 100 | -> | Plus |
3R | 17407251..17407343 | 216..308 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:16:44 Download gff for
BS28873.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 13232723..13232921 | 17..215 | 100 | -> | Plus |
arm_3R | 13232973..13233065 | 216..308 | 100 | | Plus |
BS28873.pep Sequence
Translation from 16 to 309
> BS28873.pep
MNSLIVIFGFLFISTQIVATTESECPEICLAIYSPVCEEAMINGKLVRCL
FSNSCEAGRSACLHEINWRQKEGKCETSPDHLCRQYLSSKNITSKVS*
BS28873.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:11:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42798-PA | 97 | CG42798-PA | 1..97 | 1..97 | 514 | 100 | Plus |
CG42798-PB | 57 | CG42798-PB | 1..57 | 41..97 | 310 | 100 | Plus |