Clone BS28873 Report

Search the DGRC for BS28873

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:288
Well:73
Vector:pDNR-Dual
Associated Gene/TranscriptCG42798-RA
Protein status:BS28873.pep: gold
Sequenced Size:326

Clone Sequence Records

BS28873.complete Sequence

326 bp assembled on 2012-03-26

GenBank Submission: KX801023

> BS28873.complete
GAAGTTATCAGTCGACATGAACTCGCTCATTGTAATTTTTGGATTTCTTT
TTATCTCAACTCAGATAGTCGCAACAACCGAGTCGGAATGTCCTGAAATC
TGTCTTGCAATTTACAGTCCGGTCTGTGAAGAAGCTATGATAAATGGAAA
ATTGGTTAGATGCTTATTCAGTAATAGCTGCGAAGCAGGTCGTAGCGCAT
GTCTTCATGAAATAAATTGGCGCCAAAAAGAAGGAAAATGTGAAACTTCA
CCCGACCACTTATGCCGTCAATACCTTTCATCTAAAAATATTACTTCAAA
AGTAAGCTAAAAGCTTTCTAGACCAT

BS28873.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:19:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG42798-RA 294 CG42798-PA 1..294 17..310 1470 100 Plus
CG42798-RB 174 CG42798-PB 1..174 137..310 870 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:19:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG42798-RA 500 CG42798-RA 18..311 17..310 1470 100 Plus
CG42798-RB 527 CG42798-RB 92..338 64..310 1235 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:19:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17407001..17407199 17..215 995 100 Plus
3R 32079331 3R 17407251..17407345 216..310 475 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:19:41 has no hits.

BS28873.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:15:08 Download gff for BS28873.complete
Subject Subject Range Query Range Percent Splice Strand
CG42798-RA 18..309 17..308 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:16:44 Download gff for BS28873.complete
Subject Subject Range Query Range Percent Splice Strand
CG42798-RA 18..309 17..308 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:25:43 Download gff for BS28873.complete
Subject Subject Range Query Range Percent Splice Strand
CG42798-RA 18..309 17..308 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:25:43 Download gff for BS28873.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17407001..17407199 17..215 100 -> Plus
3R 17407251..17407343 216..308 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:16:44 Download gff for BS28873.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13232723..13232921 17..215 100 -> Plus
arm_3R 13232973..13233065 216..308 100   Plus

BS28873.pep Sequence

Translation from 16 to 309

> BS28873.pep
MNSLIVIFGFLFISTQIVATTESECPEICLAIYSPVCEEAMINGKLVRCL
FSNSCEAGRSACLHEINWRQKEGKCETSPDHLCRQYLSSKNITSKVS*

BS28873.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:11:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG42798-PA 97 CG42798-PA 1..97 1..97 514 100 Plus
CG42798-PB 57 CG42798-PB 1..57 41..97 310 100 Plus