Clone BS28912 Report

Search the DGRC for BS28912

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:289
Well:12
Vector:pDNR-Dual
Associated Gene/TranscriptCG32582-RB
Protein status:BS28912.pep: full length peptide match
Sequenced Size:284

Clone Sequence Records

BS28912.complete Sequence

284 bp assembled on 2012-04-19

GenBank Submission: KX801909

> BS28912.complete
GAAGTTATCAGTCGACATGGGGCAAGGAGCTAGACGAATATTGCGGGCGT
CCCGCTCGCAGATTTGCGGTAGTCTTCGAACGGGCGAAGGGTCCAGCACC
TCAGCAAGTTGTCGAAAAGTGGTAAAAAACCCAGCTGGATTGTCCGAATT
TGACCAGTGCTCGATGCTTTGGCCGTTCGCAGTCTGCCGCATTCCTGCTA
GGCGTCCCACCCGCCCAGGATTCCTCAACCCAGGGCCATTGGGAGAGGAT
CCGTCGCTAACAGAATAAAAGCTTTCTAGACCAT

BS28912.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-28 05:17:17 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:17:18
Subject Length Description Subject Range Query Range Score Percent Strand
Rrp47-RB 1285 CG8928-RB 1132..1189 112..55 230 93.1 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:17:15
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15836523..15836673 118..268 755 100 Plus
X 23542271 X 15836295..15836397 17..119 515 100 Plus
X 23542271 X 15946096..15946153 112..55 230 93.1 Minus
Blast to na_te.dros performed on 2014-11-28 05:17:16 has no hits.

BS28912.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-19 14:05:12 Download gff for BS28912.complete
Subject Subject Range Query Range Percent Splice Strand
CG32582-RB 130..379 17..266 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:01 Download gff for BS28912.complete
Subject Subject Range Query Range Percent Splice Strand
CG32582-RB 108..357 17..266 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:47:32 Download gff for BS28912.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp47-RB 1252..1270 17..35 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:47:32 Download gff for BS28912.complete
Subject Subject Range Query Range Percent Splice Strand
X 15836295..15836397 17..119 100 -> Plus
X 15836525..15836671 120..266 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:01 Download gff for BS28912.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15730558..15730704 120..266 100   Plus
arm_X 15730328..15730430 17..119 100 -> Plus

BS28912.pep Sequence

Translation from 16 to 267

> BS28912.pep
MGQGARRILRASRSQICGSLRTGEGSSTSASCRKVVKNPAGLSEFDQCSM
LWPFAVCRIPARRPTRPGFLNPGPLGEDPSLTE*
Sequence BS28912.pep has no blast hits.