Clone BS28913 Report

Search the DGRC for BS28913

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:289
Well:13
Vector:pDNR-Dual
Associated Gene/TranscriptCG14397-RA
Protein status:BS28913.pep: full length peptide match
Sequenced Size:356

Clone Sequence Records

BS28913.complete Sequence

356 bp assembled on 2012-04-19

GenBank Submission: KX801666

> BS28913.complete
GAAGTTATCAGTCGACATGTGCCTCCTGCCCGGTCGCTTCTTCTGGTCAG
CTTTCATTGTGACGATGGTGGGTCTATCCGCAACGATCGAAGCTAGACCC
CAGAGGAATCTGCAGCACATCGCCGTGGTGGAGAATGCCGCCTGGGAAAA
GACCCTTCCGCAGCAGTTCCAGAACCCCTTCTACAATACCCCAAGGGTGA
GAGATGCCCTGGCCAGATCCAGTTGGTTTGGACCCGGCGAGGAGGTGGTT
TATGACCGCCAGGCTGAAAAAATTCCTCGCATGGAAATCTACAATGTGTT
GTCTCATGCTGGTTTGATACCACGCCGGCGTTTTCTTTAAAAGCTTTCTA
GACCAT

BS28913.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:31:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG14397-RA 324 CG14397-PA 1..324 17..340 1620 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:31:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG14397-RA 533 CG14397-RA 141..465 17..341 1625 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:31:45
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21094409..21094639 19..249 1155 100 Plus
2L 23513712 2L 21094702..21094796 247..341 475 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:31:46 has no hits.

BS28913.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-19 14:05:19 Download gff for BS28913.complete
Subject Subject Range Query Range Percent Splice Strand
CG14397-RA 127..448 17..338 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:17 Download gff for BS28913.complete
Subject Subject Range Query Range Percent Splice Strand
CG14397-RA 141..462 17..338 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:51:39 Download gff for BS28913.complete
Subject Subject Range Query Range Percent Splice Strand
CG14397-RA 141..462 17..338 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:51:39 Download gff for BS28913.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21094407..21094637 17..247 99 -> Plus
2L 21094703..21094793 248..338 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:17 Download gff for BS28913.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 21094703..21094793 248..338 100   Plus
arm_2L 21094407..21094637 17..247 99 -> Plus

BS28913.pep Sequence

Translation from 16 to 339

> BS28913.pep
MCLLPGRFFWSAFIVTMVGLSATIEARPQRNLQHIAVVENAAWEKTLPQQ
FQNPFYNTPRVRDALARSSWFGPGEEVVYDRQAEKIPRMEIYNVLSHAGL
IPRRRFL*

BS28913.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:01:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG14397-PA 107 CG14397-PA 1..107 1..107 566 100 Plus