Clone BS28919 Report

Search the DGRC for BS28919

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:289
Well:19
Vector:pDNR-Dual
Associated Gene/TranscriptCG13559-RA
Protein status:BS28919.pep: full length peptide match
Sequenced Size:377

Clone Sequence Records

BS28919.complete Sequence

377 bp assembled on 2012-04-19

GenBank Submission: KX805069

> BS28919.complete
GAAGTTATCAGTCGACATGAGTTCCTTCGCCCGGGTTCCCAGCACACCTC
CTCCTTCGTATGAGGAGGCAATGGGCTGGGAAACACGGAGATCACACAGC
ACCACGTGGCTGCTCGCGGAGAATACCTCATCACTCATGATCTGTCCAAT
GTGCCATGACGAGATCGAGACGACCACAAAGATCCGGCGCCGCTGGATCG
CCTACGTGGCCTCGGGCATAGTCTTGTTCACCACCTGCGGCATTGGATGC
TGGCTAATCCCCTGCATCCTCGACTGTTTCAACGAGATCCATCACTCGTG
TCCCGTCTGCAAGGCGACCCTGGGAATCGTTCCGCAGCAGGATCAGAGGT
GGCCAACCTAAAAGCTTTCTAGACCAT

BS28919.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:32:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG13559-RA 345 CG13559-PA 1..345 17..361 1725 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:32:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG13559-RA 870 CG13559-RA 385..729 17..361 1725 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:32:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23503330..23503674 17..361 1725 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:32:24 has no hits.

BS28919.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-19 14:05:23 Download gff for BS28919.complete
Subject Subject Range Query Range Percent Splice Strand
CG13559-RA 1..343 17..359 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:25 Download gff for BS28919.complete
Subject Subject Range Query Range Percent Splice Strand
CG13559-RA 385..727 17..359 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:51:53 Download gff for BS28919.complete
Subject Subject Range Query Range Percent Splice Strand
CG13559-RA 385..727 17..359 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:51:53 Download gff for BS28919.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23503330..23503672 17..359 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:25 Download gff for BS28919.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19390853..19391195 17..359 100   Plus

BS28919.pep Sequence

Translation from 16 to 360

> BS28919.pep
MSSFARVPSTPPPSYEEAMGWETRRSHSTTWLLAENTSSLMICPMCHDEI
ETTTKIRRRWIAYVASGIVLFTTCGIGCWLIPCILDCFNEIHHSCPVCKA
TLGIVPQQDQRWPT*

BS28919.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:02:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG13559-PA 114 CG13559-PA 1..114 1..114 641 100 Plus
CG32280-PD 130 CG32280-PD 16..126 8..103 211 39.6 Plus
CG32280-PC 130 CG32280-PC 16..126 8..103 211 39.6 Plus
CG32280-PB 130 CG32280-PB 16..126 8..103 211 39.6 Plus
CG32280-PA 130 CG32280-PA 16..126 8..103 211 39.6 Plus