Clone BS28936 Report

Search the DGRC for BS28936

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:289
Well:36
Vector:pDNR-Dual
Associated Gene/TranscriptCG14036-RA
Protein status:BS28936.pep: full length peptide match
Sequenced Size:314

Clone Sequence Records

BS28936.complete Sequence

314 bp assembled on 2012-04-19

GenBank Submission: KX804980

> BS28936.complete
GAAGTTATCAGTCGACATGTCCGATTTCGAGTACGGAATTTGCCCTTACG
ACAAATCGCACCGCATCTTGCTCTTCCGGATGCCCAAGCACTTAATTAAG
TGCGAGAAGAACTACTGTGGACCGCCGCTGCAGACCTGCAAGTACAACGC
CACACACCGAGTCCAGGACATGGAGAAGCATCTGAAGGAGTGTGACTACT
ATCTCCGCAGCATCGAAAACCAGGCGGTGCAGATAGCGCTTCGTAGTCGC
ATACCGCCCAAACAGGAAGATGGACATGATGTGGACACACCATTTTAGAA
GCTTTCTAGACCAT

BS28936.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:32:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG14036-RA 282 CG14036-PA 1..282 17..298 1410 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:32:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG14036-RA 438 CG14036-RA 65..346 17..298 1410 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:32:33
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5054671..5054952 298..17 1410 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:32:34 has no hits.

BS28936.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-19 14:05:24 Download gff for BS28936.complete
Subject Subject Range Query Range Percent Splice Strand
CG14036-RA 53..334 17..298 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:27 Download gff for BS28936.complete
Subject Subject Range Query Range Percent Splice Strand
CG14036-RA 65..346 17..298 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:51:55 Download gff for BS28936.complete
Subject Subject Range Query Range Percent Splice Strand
CG14036-RA 65..346 17..298 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:51:55 Download gff for BS28936.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5054671..5054952 17..298 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:27 Download gff for BS28936.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5054671..5054952 17..298 100   Minus

BS28936.pep Sequence

Translation from 16 to 297

> BS28936.pep
MSDFEYGICPYDKSHRILLFRMPKHLIKCEKNYCGPPLQTCKYNATHRVQ
DMEKHLKECDYYLRSIENQAVQIALRSRIPPKQEDGHDVDTPF*

BS28936.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:02:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG14036-PA 93 CG14036-PA 1..93 1..93 519 100 Plus
CG32625-PA 144 CG32625-PA 8..70 4..64 137 41.3 Plus