Clone BS28982 Report

Search the DGRC for BS28982

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:289
Well:82
Vector:pDNR-Dual
Associated Gene/TranscriptCG42323-RC
Protein status:BS28982.pep: full length peptide match
Sequenced Size:488

Clone Sequence Records

BS28982.complete Sequence

488 bp assembled on 2012-04-19

GenBank Submission: KX805693

> BS28982.complete
GAAGTTATCAGTCGACATGGCATTCAAGGTTATCCTCTCCGTTGTCCTGG
TGGCGCTGATCGCCTGCGTCCAGGCGAAGCCCGGCGGTCCGGCGGCCTAT
TCGATTAGTGCGCCCAGCGTTGACCACGCCTCCGTGGGCAGCACTCAGGA
GCATACGGTGAAGGGTCACTACGGCCAGTCCTCCCAGTCGGACTATGCCA
GCCAGGTCCAGACCGCTCACTCGCAGTCCCATGTCCAGCGGTCCAGCATC
AGCAATGACGCCGGACTGGCGCCCGTCGCCGCCCATGGCTACGCAGCTCC
CGGAATCATTGGACACGGCATTGGACTTGCCGCCCCCGCCTATGCTGCCC
CCGCCTACGCTGCTCCTGCATACGCTACGCATCTAGCTGGGCCCGTGGTG
AAGGCCGCCGTCGCCGCACCCGCCCTTGTCCACACATCGGTCTCCGGCCA
TGGTATTCACTATGGCTACTAGAAGCTTTCTAGACCAT

BS28982.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:34:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG42323-RC 456 CG42323-PC 1..456 17..472 2280 100 Plus
CG42323-RE 780 CG42323-PE 1..282 17..298 1410 100 Plus
CG42323-RE 780 CG42323-PE 604..780 296..472 885 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:34:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG42323-RC 1009 CG42323-RC 70..526 17..473 2285 100 Plus
CG42323-RE 1333 CG42323-RE 70..351 17..298 1410 100 Plus
CG42323-RE 1333 CG42323-RE 673..850 296..473 890 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:34:44
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18423492..18423761 27..296 1350 100 Plus
X 23542271 X 18426269..18426377 295..403 545 100 Plus
X 23542271 X 18426448..18426518 403..473 355 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:34:45 has no hits.

BS28982.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-19 14:05:36 Download gff for BS28982.complete
Subject Subject Range Query Range Percent Splice Strand
CG42323-RC 48..503 17..472 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:56 Download gff for BS28982.complete
Subject Subject Range Query Range Percent Splice Strand
CG42323-RC 48..503 17..472 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:52:43 Download gff for BS28982.complete
Subject Subject Range Query Range Percent Splice Strand
CG42323-RC 70..525 17..472 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:52:43 Download gff for BS28982.complete
Subject Subject Range Query Range Percent Splice Strand
X 18423481..18423761 17..296 98 -> Plus
X 18426271..18426376 297..402 100 -> Plus
X 18426448..18426517 403..472 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:56 Download gff for BS28982.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18317514..18317794 17..296 98 -> Plus
arm_X 18320304..18320409 297..402 100 -> Plus
arm_X 18320481..18320550 403..472 100   Plus

BS28982.pep Sequence

Translation from 16 to 471

> BS28982.pep
MAFKVILSVVLVALIACVQAKPGGPAAYSISAPSVDHASVGSTQEHTVKG
HYGQSSQSDYASQVQTAHSQSHVQRSSISNDAGLAPVAAHGYAAPGIIGH
GIGLAAPAYAAPAYAAPAYATHLAGPVVKAAVAAPALVHTSVSGHGIHYG
Y*

BS28982.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:04:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG42323-PC 151 CG42323-PC 1..151 1..151 770 100 Plus
CG42323-PE 259 CG42323-PE 1..147 1..151 499 72.2 Plus
CG42323-PE 259 CG42323-PE 97..259 27..151 317 48.5 Plus