Clone BS29311 Report

Search the DGRC for BS29311

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:293
Well:11
Vector:pDNR-Dual
Associated Gene/TranscriptCG33557-RA
Protein status:BS29311.pep: gold
Sequenced Size:485

Clone Sequence Records

BS29311.complete Sequence

485 bp assembled on 2012-05-07

GenBank Submission: KX804722

> BS29311.complete
GAAGTTATCAGTCGACATGGCGGTCTCATCGTCCTCGTCGTCGTTTTCCA
ACTACTTGATGGCGGTATTTGCCCAGGATAGCAATAGTAGTGGCAGTGCC
AGCGGAAGTGGAGCAGCCGCCGACTCGGAGGACTCCCAGATTGGCCAGGA
GGCCAATCCAGGTGGCCAGGAGAATCAGGGAAATCACAGGAGGCGACCGC
CGCGCCAGAAGATCAATGCTAGAGAGCGCTATCGGACATTTAATGTTAAT
TCGGCCTACGAGGCATTAAGAAATTTAATACCCACGGAGCCCATGAATCG
CAAGCTTTCAAAGATCGAGATCATCCGCCTGGCCAGCAGCTATATAACGC
ACCTAAGTAGCACCCTAGAAACAGGCACTGAATGCCAGCCATGTTTGCTG
CACAAATACGAGAGCGAAGGAATAACTAGACGTATCAGTATCTGCACCTT
TTGCCTGAAAACCAAATAAAAGCTTTCTAGACCAT

BS29311.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 12:55:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG33557-RA 453 CG33557-PA 1..451 17..467 2255 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:55:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG33557-RA 674 CG33557-RA 26..480 17..471 2260 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 12:55:19
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10009235..10009461 17..243 1135 100 Plus
X 23542271 X 10009571..10009702 244..375 660 100 Plus
X 23542271 X 10009757..10009855 373..471 480 99 Plus
Blast to na_te.dros performed on 2014-11-28 12:55:20 has no hits.

BS29311.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-05-07 11:48:37 Download gff for BS29311.complete
Subject Subject Range Query Range Percent Splice Strand
CG33557-RA 1..451 17..467 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:48:12 Download gff for BS29311.complete
Subject Subject Range Query Range Percent Splice Strand
CG33557-RA 26..476 17..467 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:16:52 Download gff for BS29311.complete
Subject Subject Range Query Range Percent Splice Strand
CG33557-RA 26..476 17..467 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:16:52 Download gff for BS29311.complete
Subject Subject Range Query Range Percent Splice Strand
X 10009235..10009461 17..243 100 -> Plus
X 10009571..10009701 244..374 100 -> Plus
X 10009759..10009851 375..467 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:48:12 Download gff for BS29311.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 9903268..9903494 17..243 100 -> Plus
arm_X 9903604..9903734 244..374 100 -> Plus
arm_X 9903792..9903884 375..467 100   Plus

BS29311.pep Sequence

Translation from 16 to 468

> BS29311.pep
MAVSSSSSSFSNYLMAVFAQDSNSSGSASGSGAAADSEDSQIGQEANPGG
QENQGNHRRRPPRQKINARERYRTFNVNSAYEALRNLIPTEPMNRKLSKI
EIIRLASSYITHLSSTLETGTECQPCLLHKYESEGITRRISICTFCLKTK
*

BS29311.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:28:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG33557-PA 150 CG33557-PA 1..150 1..150 765 100 Plus
Fer1-PA 251 CG33323-PA 23..157 2..134 153 30.9 Plus
Fer1-PB 256 CG33323-PB 23..162 2..134 148 31 Plus