BS29517.complete Sequence
317 bp assembled on 2012-05-25
GenBank Submission: KX805183
> BS29517.complete
GAAGTTATCAGTCGACATGAGCTTTGCTCTTAGATTGGGATCTTCAATCG
GGTGTTTTCACCGTACGATCTTAGGTCGTGACATAATTCAAAGGAAAAGT
CATGTGGTATCTTACCGCAATGGCCCCCCTCCCCATTCAAAGGCAACTAA
AATTGGTGCTTTAACTGTTGGAGGAGCTATGTGGTGGTGGGTAATCTGGC
ACTTATGGCATGAACCTGACCATATAACGGGGGAATTTGATTATCCTAAC
TCAAGGAAATGGAGCAACACAGAGTTGGGTGTTCCAAAGGATGGATTTTA
AAAGCTTTCTAGACCAT
BS29517.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:28:54
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG40472-RC | 285 | CG40472-PC | 1..285 | 17..301 | 1425 | 100 | Plus |
| CG40002-RB | 285 | CG40002-PB | 1..285 | 17..301 | 1425 | 100 | Plus |
| CG40002-RA | 285 | CG40002-PA | 1..285 | 17..301 | 1425 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:28:55
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG40472-RC | 460 | CR40472-RC | 135..420 | 17..302 | 1430 | 100 | Plus |
| CG40002-RB | 445 | CG40002-RB | 93..378 | 17..302 | 1430 | 100 | Plus |
| CG40002-RA | 745 | CG40002-RA | 93..378 | 17..302 | 1430 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:28:52
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3L | 28110227 | 3L | 24976489..24976613 | 106..230 | 625 | 100 | Plus |
| 3L | 28110227 | 3L | 24927407..24927531 | 106..230 | 625 | 100 | Plus |
| 3L | 28110227 | 3L | 24927264..24927353 | 17..106 | 450 | 100 | Plus |
| 3L | 28110227 | 3L | 24976346..24976435 | 17..106 | 450 | 100 | Plus |
| 3L | 28110227 | 3L | 24927597..24927670 | 229..302 | 370 | 100 | Plus |
| 3L | 28110227 | 3L | 24976678..24976751 | 229..302 | 370 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 11:28:53 has no hits.
BS29517.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-05-25 09:30:10 Download gff for
BS29517.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG40002-RA | 93..375 | 17..299 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:24 Download gff for
BS29517.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG40472-RC | 135..417 | 17..299 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:44:29 Download gff for
BS29517.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG40002-RA | 93..375 | 17..299 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:44:29 Download gff for
BS29517.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 24976346..24976434 | 17..105 | 100 | -> | Plus |
| 3L | 24976489..24976612 | 106..229 | 100 | -> | Plus |
| 3L | 24976679..24976748 | 230..299 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:24 Download gff for
BS29517.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3LHet | 459678..459766 | 17..105 | 100 | -> | Plus |
| 3LHet | 459821..459944 | 106..229 | 100 | -> | Plus |
| 3LHet | 460011..460080 | 230..299 | 100 | | Plus |
BS29517.pep Sequence
Translation from 16 to 300
> BS29517.pep
MSFALRLGSSIGCFHRTILGRDIIQRKSHVVSYRNGPPPHSKATKIGALT
VGGAMWWWVIWHLWHEPDHITGEFDYPNSRKWSNTELGVPKDGF*
BS29517.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:59:54
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG40472-PC | 94 | CR40472-PC | 1..94 | 1..94 | 535 | 100 | Plus |
| CG40002-PB | 94 | CG40002-PB | 1..94 | 1..94 | 535 | 100 | Plus |
| CG40002-PA | 94 | CG40002-PA | 1..94 | 1..94 | 535 | 100 | Plus |
