BS29519.complete Sequence
245 bp assembled on 2012-05-25
GenBank Submission: KX800848
> BS29519.complete
GAAGTTATCAGTCGACATGCCAAATCCACTGTGGTTCGTCTTCTGGCTGC
TGGTCTTCTGGTTCGTCTCCTTCTTCGTGGCATTCTTCTGCGCCTTTTTC
TACATCTGGGTCTACGCATTTGCCTCCTGCATTCCCGCCCTGACGGGCAT
ATCGGACATTCTGCTCCAGGGAGTCCAGTTCCCGTTCTACTGCGGGAAAG
CCATGTTAGAGGGCAAGCAAGCTTTTTAAAAGCTTTCTAGACCAT
BS29519.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:28:57
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG11686-RB | 213 | CG11686-PB | 1..213 | 17..229 | 1065 | 100 | Plus |
| CG11686-RA | 213 | CG11686-PA | 1..213 | 17..229 | 1065 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:28:57
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG11686-RB | 487 | CG11686-RB | 169..381 | 17..229 | 1065 | 100 | Plus |
| CG11686-RA | 419 | CG11686-RA | 101..313 | 17..229 | 1065 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:28:55
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 13261642..13261771 | 17..146 | 650 | 100 | Plus |
| 3R | 32079331 | 3R | 13262037..13262121 | 145..229 | 425 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 11:28:56 has no hits.
BS29519.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-05-25 09:30:11 Download gff for
BS29519.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG11686-RA | 100..310 | 17..227 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:26 Download gff for
BS29519.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG11686-RA | 101..311 | 17..227 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:44:30 Download gff for
BS29519.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG11686-RA | 101..311 | 17..227 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:44:30 Download gff for
BS29519.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 13261642..13261770 | 17..145 | 100 | -> | Plus |
| 3R | 13262038..13262119 | 146..227 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:26 Download gff for
BS29519.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3R | 9087364..9087492 | 17..145 | 100 | -> | Plus |
| arm_3R | 9087760..9087841 | 146..227 | 100 | | Plus |
BS29519.pep Sequence
Translation from 16 to 228
> BS29519.pep
MPNPLWFVFWLLVFWFVSFFVAFFCAFFYIWVYAFASCIPALTGISDILL
QGVQFPFYCGKAMLEGKQAF*
BS29519.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:59:55
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG11686-PB | 70 | CG11686-PB | 1..70 | 1..70 | 393 | 100 | Plus |
| CG11686-PA | 70 | CG11686-PA | 1..70 | 1..70 | 393 | 100 | Plus |
