Clone BS29521 Report

Search the DGRC for BS29521

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:295
Well:21
Vector:pDNR-Dual
Associated Gene/TranscriptIM4-RA
Protein status:BS29521.pep: full length peptide match
Sequenced Size:161

Clone Sequence Records

BS29521.complete Sequence

161 bp assembled on 2012-05-25

GenBank Submission: KX804171

> BS29521.complete
GAAGTTATCAGTCGACATGAAGTTCTTCCAAGCCGCCGCCCTTCTCTTGG
CCATGTTCGCTGCCCTCGCCAACGCCGAGCCCGTTCCCCAACCTGGAACC
GTGCTCATCCAGACCGACAACACCCAGTACATTCGTACTGGTTAGAAGCT
TTCTAGACCAT

BS29521.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:29:02
Subject Length Description Subject Range Query Range Score Percent Strand
IM4-RB 129 CG15231-PB 1..129 17..145 645 100 Plus
IM4-RA 129 CG15231-PA 1..129 17..145 645 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:29:03
Subject Length Description Subject Range Query Range Score Percent Strand
IM4-RB 767 CG15231-RB 63..193 15..145 655 100 Plus
IM4-RA 418 CG15231-RA 63..193 15..145 655 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:29:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20869182..20869259 92..15 390 100 Minus
2R 25286936 2R 20869070..20869122 145..93 265 100 Minus
Blast to na_te.dros performed on 2014-11-28 11:29:02 has no hits.

BS29521.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-05-25 09:30:12 Download gff for BS29521.complete
Subject Subject Range Query Range Percent Splice Strand
IM4-RA 65..193 17..145 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:30 Download gff for BS29521.complete
Subject Subject Range Query Range Percent Splice Strand
IM4-RA 65..193 17..145 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:44:34 Download gff for BS29521.complete
Subject Subject Range Query Range Percent Splice Strand
IM4-RA 65..193 17..145 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:44:34 Download gff for BS29521.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20869070..20869122 93..145 100 <- Minus
2R 20869182..20869257 17..92 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:30 Download gff for BS29521.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16756575..16756627 93..145 100 <- Minus
arm_2R 16756687..16756762 17..92 100   Minus

BS29521.pep Sequence

Translation from 16 to 144

> BS29521.pep
MKFFQAAALLLAMFAALANAEPVPQPGTVLIQTDNTQYIRTG*

BS29521.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:00:09
Subject Length Description Subject Range Query Range Score Percent Strand
IM4-PB 42 CG15231-PB 1..42 1..42 209 100 Plus
IM4-PA 42 CG15231-PA 1..42 1..42 209 100 Plus