BS29521.complete Sequence
161 bp assembled on 2012-05-25
GenBank Submission: KX804171
> BS29521.complete
GAAGTTATCAGTCGACATGAAGTTCTTCCAAGCCGCCGCCCTTCTCTTGG
CCATGTTCGCTGCCCTCGCCAACGCCGAGCCCGTTCCCCAACCTGGAACC
GTGCTCATCCAGACCGACAACACCCAGTACATTCGTACTGGTTAGAAGCT
TTCTAGACCAT
BS29521.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:29:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
IM4-RB | 129 | CG15231-PB | 1..129 | 17..145 | 645 | 100 | Plus |
IM4-RA | 129 | CG15231-PA | 1..129 | 17..145 | 645 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:29:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
IM4-RB | 767 | CG15231-RB | 63..193 | 15..145 | 655 | 100 | Plus |
IM4-RA | 418 | CG15231-RA | 63..193 | 15..145 | 655 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:29:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 20869182..20869259 | 92..15 | 390 | 100 | Minus |
2R | 25286936 | 2R | 20869070..20869122 | 145..93 | 265 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 11:29:02 has no hits.
BS29521.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-05-25 09:30:12 Download gff for
BS29521.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IM4-RA | 65..193 | 17..145 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:30 Download gff for
BS29521.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IM4-RA | 65..193 | 17..145 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:44:34 Download gff for
BS29521.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IM4-RA | 65..193 | 17..145 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:44:34 Download gff for
BS29521.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 20869070..20869122 | 93..145 | 100 | <- | Minus |
2R | 20869182..20869257 | 17..92 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:30 Download gff for
BS29521.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 16756575..16756627 | 93..145 | 100 | <- | Minus |
arm_2R | 16756687..16756762 | 17..92 | 100 | | Minus |
BS29521.pep Sequence
Translation from 16 to 144
> BS29521.pep
MKFFQAAALLLAMFAALANAEPVPQPGTVLIQTDNTQYIRTG*
BS29521.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:00:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
IM4-PB | 42 | CG15231-PB | 1..42 | 1..42 | 209 | 100 | Plus |
IM4-PA | 42 | CG15231-PA | 1..42 | 1..42 | 209 | 100 | Plus |