Clone BS29524 Report

Search the DGRC for BS29524

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:295
Well:24
Vector:pDNR-Dual
Associated Gene/TranscriptCG1674-RD
Protein status:BS29524.pep: full length peptide match
Sequenced Size:827

Clone Sequence Records

BS29524.complete Sequence

827 bp assembled on 2012-05-25

GenBank Submission: KX806150

> BS29524.complete
GAAGTTATCAGTCGACATGGATTCTACTTTAAATATTGAGAATGTCAATG
ACCCAACATCCATTGCATCTGATTTATCGGCCGAAAACACTAAAGCAGAC
CTTGTTTCGCTAAATGAACCGAATGTCAATGACCAAACATCCAGTGCATC
TGATTTGACGGCCGAAAACACTAAAGCAGACCATGATTCGCTAAATAAAC
CTAAGGATTTTAATAACCAAATTCTGAACATTATATCGGATATAGATATA
AATATAAAAGCACAGGAAAAAATAACACAGCTTAAAGAACAAGAACTAAA
ACTCATTCAGAAACAGAATGATCTGGCAAATGAAATCCATAAGCAGCAGA
TCCTAGCTAAGCAGCTTAGTGCACAAAATCAGCTTAAACAAAATGAATGT
CAAAGTGGAGAGCTCGACTTACACAGTCAATATCAAAATGAGCGCGGCGG
ACCCACCTCGACACTGTATCAGGAAAAAAATATAGCCAGTAAAGAATCCG
CTAATGTGTCGAAGACGGTTGATTTGCGAAAAATATTTACACCTGCGACC
GATGCTGCTGAAATATTACCGAAAAACCGAAAGCTATATGCCTCGTCTGC
ATTTTATTCTCCAACACTACACCCTACAGTGGAAGACCAAGTCGAGCTAG
CTCGAAGAATTTCACATTCATTAAGCGATATAAGTAATCAAACCTCTAAG
GGTCAGTCTATGTATGTCAATCGCAAAAAACGCTCAGACAAATGGGTTCA
TGAAGGTGGATCTCAAGGTAATGTTTTTTTTCAATATTTTTTGTTGTCAG
TCAGTTATTAAAAGCTTTCTAGACCAT

BS29524.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:28:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG1674-RD 795 CG1674-PD 1..795 17..811 3975 100 Plus
CG1674-RJ 2085 CG1674-PJ 1..757 17..773 3770 99.9 Plus
CG1674-RI 1770 CG1674-PI 1..751 17..767 3755 100 Plus
CG1674-RD 795 CG1674-PD 24..104 121..201 300 91.4 Plus
CG1674-RD 795 CG1674-PD 105..185 40..120 300 91.4 Plus
CG1674-RJ 2085 CG1674-PJ 24..104 121..201 300 91.4 Plus
CG1674-RJ 2085 CG1674-PJ 105..185 40..120 300 91.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:28:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG1674-RD 1457 CG1674-RD 222..1016 17..811 3975 100 Plus
CG1674-RJ 2419 CG1674-RJ 195..951 17..773 3770 99.9 Plus
CG1674-RI 2131 CG1674-RI 222..972 17..767 3755 100 Plus
CG1674-RD 1457 CG1674-RD 245..325 121..201 300 91.4 Plus
CG1674-RD 1457 CG1674-RD 326..406 40..120 300 91.4 Plus
CG1674-RJ 2419 CG1674-RJ 218..298 121..201 300 91.4 Plus
CG1674-RJ 2419 CG1674-RJ 299..379 40..120 300 91.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:28:45
Subject Length Description Subject Range Query Range Score Percent Strand
4 1348131 4 237269..237560 203..494 1460 100 Plus
4 1348131 4 240645..240877 579..811 1165 100 Plus
4 1348131 4 240314..240410 494..590 440 96.9 Plus
4 1348131 4 234263..234345 39..121 415 100 Plus
4 1348131 4 236394..236475 121..202 410 100 Plus
4 1348131 4 236393..236474 39..120 305 91.5 Plus
4 1348131 4 234264..234344 121..201 300 91.4 Plus
Blast to na_te.dros performed 2014-11-28 11:28:45
Subject Length Description Subject Range Query Range Score Percent Strand
Tirant 8526 Tirant TIRANT 8526bp 577..646 246..315 116 62.9 Plus

BS29524.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-05-25 09:30:09 Download gff for BS29524.complete
Subject Subject Range Query Range Percent Splice Strand
CG1674-RD 218..1010 17..809 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:20 Download gff for BS29524.complete
Subject Subject Range Query Range Percent Splice Strand
CG1674-RD 222..1014 17..809 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:44:26 Download gff for BS29524.complete
Subject Subject Range Query Range Percent Splice Strand
CG1674-RD 222..1014 17..809 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:44:26 Download gff for BS29524.complete
Subject Subject Range Query Range Percent Splice Strand
4 231954..231977 17..40 100 -> Plus
4 234265..234345 41..121 100 -> Plus
4 236395..236475 122..202 100 -> Plus
4 237269..237559 203..493 100 -> Plus
4 240314..240398 494..578 100 -> Plus
4 240645..240875 579..809 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:20 Download gff for BS29524.complete
Subject Subject Range Query Range Percent Splice Strand
arm_4 254891..254971 41..121 100 -> Plus
arm_4 257021..257101 122..202 100 -> Plus
arm_4 252580..252603 17..40 100 -> Plus
arm_4 257895..258185 203..493 100 -> Plus
arm_4 260940..261024 494..578 100 -> Plus
arm_4 261271..261501 579..809 100   Plus

BS29524.pep Sequence

Translation from 16 to 810

> BS29524.pep
MDSTLNIENVNDPTSIASDLSAENTKADLVSLNEPNVNDQTSSASDLTAE
NTKADHDSLNKPKDFNNQILNIISDIDINIKAQEKITQLKEQELKLIQKQ
NDLANEIHKQQILAKQLSAQNQLKQNECQSGELDLHSQYQNERGGPTSTL
YQEKNIASKESANVSKTVDLRKIFTPATDAAEILPKNRKLYASSAFYSPT
LHPTVEDQVELARRISHSLSDISNQTSKGQSMYVNRKKRSDKWVHEGGSQ
GNVFFQYFLLSVSY*

BS29524.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:59:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG1674-PD 264 CG1674-PD 1..264 1..264 1332 100 Plus
CG1674-PJ 694 CG1674-PJ 1..252 1..252 1271 100 Plus
CG1674-PI 589 CG1674-PI 1..255 1..257 1260 98.4 Plus
CG1674-PK 860 CG1674-PK 1..279 1..252 1233 90.3 Plus
CG1674-PH 884 CG1674-PH 198..442 8..252 1233 99.6 Plus