Clone BS29531 Report

Search the DGRC for BS29531

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:295
Well:31
Vector:pDNR-Dual
Associated Gene/TranscriptCG3566-RC
Protein status:BS29531.pep: full length peptide match
Sequenced Size:302

Clone Sequence Records

BS29531.complete Sequence

302 bp assembled on 2012-05-25

GenBank Submission: KX801798

> BS29531.complete
GAAGTTATCAGTCGACATGAGCAAGGAAATCCGTTTGGCCACCGTCAACG
AACACAACAAAGCCACGGATCTGTGGGTGGTCATCGACAACAAGGTCTAC
GATGTGACCAAGTTCCGTCTCGAGCATCCCGGTGGCGAGGAATCCCTGGT
GGATGAGGCCGGTCGCGATGCCACCAAGGCCTTCAATGACGTGGGTCACA
GCTCGGAGGCGAGAGAGATGTTGAAGAAATACTACATTGGTGACCTGGCT
GCTGCGGACATCAAGAAGAAAAGCCCAATTAGGTGAAAGCTTTCTAGACC
AT

BS29531.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:29:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG3566-RC 270 CG3566-PC 1..270 17..286 1350 100 Plus
CG3566-RD 321 CG3566-PD 1..266 17..282 1330 100 Plus
CG3566-RB 354 CG3566-PB 1..266 17..282 1330 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:29:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG3566-RC 1607 CG3566-RC 86..355 17..286 1350 100 Plus
CG3566-RD 770 CG3566-RD 86..351 17..282 1330 100 Plus
CG3566-RB 550 CG3566-RB 86..351 17..282 1330 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:29:19
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6276532..6276639 124..17 540 100 Minus
X 23542271 X 6276370..6276465 213..118 465 99 Minus
X 23542271 X 6276224..6276298 286..212 375 100 Minus
Blast to na_te.dros performed on 2014-11-28 11:29:20 has no hits.

BS29531.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-05-25 09:30:16 Download gff for BS29531.complete
Subject Subject Range Query Range Percent Splice Strand
CG3566-RC 40..308 17..285 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:42 Download gff for BS29531.complete
Subject Subject Range Query Range Percent Splice Strand
CG3566-RC 86..354 17..285 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:44:45 Download gff for BS29531.complete
Subject Subject Range Query Range Percent Splice Strand
CG3566-RC 86..354 17..285 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:44:45 Download gff for BS29531.complete
Subject Subject Range Query Range Percent Splice Strand
X 6276225..6276296 214..285 100 <- Minus
X 6276370..6276458 125..213 100 <- Minus
X 6276532..6276639 17..124 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:42 Download gff for BS29531.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6170258..6170329 214..285 100 <- Minus
arm_X 6170403..6170491 125..213 100 <- Minus
arm_X 6170565..6170672 17..124 100   Minus

BS29531.pep Sequence

Translation from 16 to 285

> BS29531.pep
MSKEIRLATVNEHNKATDLWVVIDNKVYDVTKFRLEHPGGEESLVDEAGR
DATKAFNDVGHSSEAREMLKKYYIGDLAAADIKKKSPIR*

BS29531.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:00:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG3566-PC 89 CG3566-PC 1..89 1..89 457 100 Plus
CG3566-PD 106 CG3566-PD 1..88 1..88 452 100 Plus
CG3566-PB 117 CG3566-PB 1..88 1..88 452 100 Plus
Cyt-b5-PB 134 CG2140-PB 6..85 2..81 235 52.5 Plus
CG6870-PB 137 CG6870-PB 43..116 4..77 205 52.7 Plus