BS29541.complete Sequence
209 bp assembled on 2012-05-25
GenBank Submission: KX802860
> BS29541.complete
GAAGTTATCAGTCGACATGCGCCAGCTGAAGGGAAAGGTGAAGGAGACGC
GCAAACAGAAGAAGGAGCGCAAGCTGGACAACCTGGAGACCCAGGCGAAG
ATCCGCACCGTGGTGCTGCCGGCGCTCGGCGTTTTGGCGGTCTTTCTGGT
GCTGTTCGTCTACTTGAAGACCCGCCCCGCGGTCTTGGCCTAAAAGCTTT
CTAGACCAT
BS29541.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:29:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33169-RC | 177 | CG33169-PC | 1..177 | 17..193 | 885 | 100 | Plus |
CG33169-RA | 177 | CG33169-PA | 1..177 | 17..193 | 885 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:29:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33169-RC | 396 | CG33169-RC | 120..296 | 17..193 | 885 | 100 | Plus |
CG33169-RA | 633 | CG33169-RA | 120..296 | 17..193 | 885 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:29:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 22863983..22864159 | 17..193 | 885 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 11:29:39 has no hits.
BS29541.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-05-25 09:30:20 Download gff for
BS29541.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33169-RA | 120..294 | 17..191 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:52 Download gff for
BS29541.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33169-RA | 120..294 | 17..191 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:44:56 Download gff for
BS29541.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33169-RA | 120..294 | 17..191 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:44:56 Download gff for
BS29541.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 22863983..22864157 | 17..191 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:52 Download gff for
BS29541.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 22857083..22857257 | 17..191 | 100 | | Plus |
BS29541.pep Sequence
Translation from 16 to 192
> BS29541.pep
MRQLKGKVKETRKQKKERKLDNLETQAKIRTVVLPALGVLAVFLVLFVYL
KTRPAVLA*
BS29541.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:00:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33169-PC | 58 | CG33169-PC | 1..58 | 1..58 | 278 | 100 | Plus |
CG33169-PA | 58 | CG33169-PA | 1..58 | 1..58 | 278 | 100 | Plus |