Clone BS29541 Report

Search the DGRC for BS29541

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:295
Well:41
Vector:pDNR-Dual
Associated Gene/TranscriptCG33169-RA
Protein status:BS29541.pep: full length peptide match
Sequenced Size:209

Clone Sequence Records

BS29541.complete Sequence

209 bp assembled on 2012-05-25

GenBank Submission: KX802860

> BS29541.complete
GAAGTTATCAGTCGACATGCGCCAGCTGAAGGGAAAGGTGAAGGAGACGC
GCAAACAGAAGAAGGAGCGCAAGCTGGACAACCTGGAGACCCAGGCGAAG
ATCCGCACCGTGGTGCTGCCGGCGCTCGGCGTTTTGGCGGTCTTTCTGGT
GCTGTTCGTCTACTTGAAGACCCGCCCCGCGGTCTTGGCCTAAAAGCTTT
CTAGACCAT

BS29541.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:29:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG33169-RC 177 CG33169-PC 1..177 17..193 885 100 Plus
CG33169-RA 177 CG33169-PA 1..177 17..193 885 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:29:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG33169-RC 396 CG33169-RC 120..296 17..193 885 100 Plus
CG33169-RA 633 CG33169-RA 120..296 17..193 885 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:29:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 22863983..22864159 17..193 885 100 Plus
Blast to na_te.dros performed on 2014-11-28 11:29:39 has no hits.

BS29541.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-05-25 09:30:20 Download gff for BS29541.complete
Subject Subject Range Query Range Percent Splice Strand
CG33169-RA 120..294 17..191 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:52 Download gff for BS29541.complete
Subject Subject Range Query Range Percent Splice Strand
CG33169-RA 120..294 17..191 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:44:56 Download gff for BS29541.complete
Subject Subject Range Query Range Percent Splice Strand
CG33169-RA 120..294 17..191 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:44:56 Download gff for BS29541.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22863983..22864157 17..191 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:52 Download gff for BS29541.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 22857083..22857257 17..191 100   Plus

BS29541.pep Sequence

Translation from 16 to 192

> BS29541.pep
MRQLKGKVKETRKQKKERKLDNLETQAKIRTVVLPALGVLAVFLVLFVYL
KTRPAVLA*

BS29541.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:00:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG33169-PC 58 CG33169-PC 1..58 1..58 278 100 Plus
CG33169-PA 58 CG33169-PA 1..58 1..58 278 100 Plus