BS29543.complete Sequence
206 bp assembled on 2012-05-25
GenBank Submission: KX801862
> BS29543.complete
GAAGTTATCAGTCGACATGGCTTTCCGCATACCTTTTGGCAAGAAGCACG
CTGAGATAGCGAGTTCCTTCATCCGATCTGGAGCCGGATTCGGAGGAGCT
GCTGGCCTGGCCGTGCTTTACTACACCGACTGGAAGCTGGTCCTACAGTA
CGTGCCCATCTACGGATCCAAGTTCGAAAAAAGCGAGTAAAAGCTTTCTA
GACCAT
BS29543.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:29:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14482-RB | 174 | CG14482-PB | 1..174 | 17..190 | 870 | 100 | Plus |
CG14482-RA | 174 | CG14482-PA | 1..174 | 17..190 | 870 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:29:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14482-RB | 561 | CG14482-RB | 81..254 | 17..190 | 870 | 100 | Plus |
CG14482-RA | 324 | CG14482-RA | 81..254 | 17..190 | 870 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:29:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 17572403..17572523 | 190..70 | 605 | 100 | Minus |
2R | 25286936 | 2R | 17572652..17572704 | 69..17 | 265 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 11:29:45 has no hits.
BS29543.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-05-25 09:30:22 Download gff for
BS29543.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14482-RA | 51..222 | 17..188 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:56 Download gff for
BS29543.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14482-RA | 81..252 | 17..188 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:44:59 Download gff for
BS29543.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14482-RA | 81..252 | 17..188 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:44:59 Download gff for
BS29543.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 17572405..17572523 | 70..188 | 100 | <- | Minus |
2R | 17572652..17572704 | 17..69 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:56 Download gff for
BS29543.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 13459910..13460028 | 70..188 | 100 | <- | Minus |
arm_2R | 13460157..13460209 | 17..69 | 100 | | Minus |
BS29543.pep Sequence
Translation from 16 to 189
> BS29543.pep
MAFRIPFGKKHAEIASSFIRSGAGFGGAAGLAVLYYTDWKLVLQYVPIYG
SKFEKSE*
BS29543.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:00:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14482-PB | 57 | CG14482-PB | 1..57 | 1..57 | 296 | 100 | Plus |
CG14482-PA | 57 | CG14482-PA | 1..57 | 1..57 | 296 | 100 | Plus |
CG43206-PA | 72 | CG43206-PA | 18..66 | 9..57 | 130 | 49 | Plus |