Clone BS29543 Report

Search the DGRC for BS29543

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:295
Well:43
Vector:pDNR-Dual
Associated Gene/TranscriptCG14482-RA
Protein status:BS29543.pep: full length peptide match
Sequenced Size:206

Clone Sequence Records

BS29543.complete Sequence

206 bp assembled on 2012-05-25

GenBank Submission: KX801862

> BS29543.complete
GAAGTTATCAGTCGACATGGCTTTCCGCATACCTTTTGGCAAGAAGCACG
CTGAGATAGCGAGTTCCTTCATCCGATCTGGAGCCGGATTCGGAGGAGCT
GCTGGCCTGGCCGTGCTTTACTACACCGACTGGAAGCTGGTCCTACAGTA
CGTGCCCATCTACGGATCCAAGTTCGAAAAAAGCGAGTAAAAGCTTTCTA
GACCAT

BS29543.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:29:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG14482-RB 174 CG14482-PB 1..174 17..190 870 100 Plus
CG14482-RA 174 CG14482-PA 1..174 17..190 870 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:29:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG14482-RB 561 CG14482-RB 81..254 17..190 870 100 Plus
CG14482-RA 324 CG14482-RA 81..254 17..190 870 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:29:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17572403..17572523 190..70 605 100 Minus
2R 25286936 2R 17572652..17572704 69..17 265 100 Minus
Blast to na_te.dros performed on 2014-11-28 11:29:45 has no hits.

BS29543.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-05-25 09:30:22 Download gff for BS29543.complete
Subject Subject Range Query Range Percent Splice Strand
CG14482-RA 51..222 17..188 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:56 Download gff for BS29543.complete
Subject Subject Range Query Range Percent Splice Strand
CG14482-RA 81..252 17..188 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:44:59 Download gff for BS29543.complete
Subject Subject Range Query Range Percent Splice Strand
CG14482-RA 81..252 17..188 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:44:59 Download gff for BS29543.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17572405..17572523 70..188 100 <- Minus
2R 17572652..17572704 17..69 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:56 Download gff for BS29543.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13459910..13460028 70..188 100 <- Minus
arm_2R 13460157..13460209 17..69 100   Minus

BS29543.pep Sequence

Translation from 16 to 189

> BS29543.pep
MAFRIPFGKKHAEIASSFIRSGAGFGGAAGLAVLYYTDWKLVLQYVPIYG
SKFEKSE*

BS29543.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:00:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG14482-PB 57 CG14482-PB 1..57 1..57 296 100 Plus
CG14482-PA 57 CG14482-PA 1..57 1..57 296 100 Plus
CG43206-PA 72 CG43206-PA 18..66 9..57 130 49 Plus