BS29547.complete Sequence
398 bp assembled on 2012-05-25
GenBank Submission: KX805943
> BS29547.complete
GAAGTTATCAGTCGACATGCTTTTCGATGGCGAAACCGGCAATGGGCAAG
GTCAGGGCCAGAATACCCTGAATCCATTGGGGCCAGGCCAGGAGGAGCCC
GCCCTATGCGAGCAGTACTATCTGCTGGGCGATGGTTCCATCATTCTGCG
CAACCATTCCATCGACTTGTCGAATCCGCCCCTGAAATCGCGCTGCTGCC
AGCTCCCAACACTCATCCACGACATATGCGTCAACTGCGTGATGGATCTC
TGCGAGGAGTGTGGCTACTCCTGCGGCGAGTGCGCCAAGTTTATTTGCCG
CAACTGCGTGACTTTATTTGGTAATCGAATTGAAGAAGAGGAGGATCCGC
TGTGCGAGCACTGCCAGATGTTCCTCAGCTAGAAGCTTTCTAGACCAT
BS29547.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:29:27
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG3176-RD | 366 | CG3176-PD | 1..366 | 17..382 | 1830 | 100 | Plus |
| CG3176-RA | 366 | CG3176-PA | 1..366 | 17..382 | 1830 | 100 | Plus |
| CG32817-RB | 366 | CG32817-PB | 1..366 | 17..382 | 1785 | 99.2 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:29:28
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG3176-RD | 627 | CG3176-RD | 75..440 | 17..382 | 1830 | 100 | Plus |
| CG3176-RA | 517 | CG3176-RA | 75..440 | 17..382 | 1830 | 100 | Plus |
| CG32817-RB | 580 | CG32817-RB | 142..507 | 17..382 | 1785 | 99.2 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:29:26
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| X | 23542271 | X | 482132..482433 | 17..318 | 1510 | 100 | Plus |
| X | 23542271 | X | 479644..479945 | 17..318 | 1480 | 99.3 | Plus |
| X | 23542271 | X | 477621..477931 | 17..318 | 1025 | 89.4 | Plus |
| X | 23542271 | X | 482518..482581 | 319..382 | 320 | 100 | Plus |
| X | 23542271 | X | 480030..480093 | 319..382 | 305 | 98.4 | Plus |
| X | 23542271 | X | 478013..478075 | 319..381 | 255 | 93.7 | Plus |
Blast to na_te.dros performed on 2014-11-28 11:29:26 has no hits.
BS29547.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-05-25 09:30:18 Download gff for
BS29547.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG3176-RA | 151..516 | 17..382 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:45 Download gff for
BS29547.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG3176-RA | 75..440 | 17..382 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:44:49 Download gff for
BS29547.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG3176-RA | 75..440 | 17..382 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:44:49 Download gff for
BS29547.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| X | 482132..482433 | 17..318 | 100 | -> | Plus |
| X | 482518..482581 | 319..382 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:45 Download gff for
BS29547.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_X | 376165..376466 | 17..318 | 100 | -> | Plus |
| arm_X | 376551..376614 | 319..382 | 100 | | Plus |
BS29547.pep Sequence
Translation from 16 to 381
> BS29547.pep
MLFDGETGNGQGQGQNTLNPLGPGQEEPALCEQYYLLGDGSIILRNHSID
LSNPPLKSRCCQLPTLIHDICVNCVMDLCEECGYSCGECAKFICRNCVTL
FGNRIEEEEDPLCEHCQMFLS*
BS29547.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:00:20
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG3176-PD | 121 | CG3176-PD | 1..121 | 1..121 | 683 | 100 | Plus |
| CG3176-PA | 121 | CG3176-PA | 1..121 | 1..121 | 683 | 100 | Plus |
| CG32817-PB | 121 | CG32817-PB | 1..121 | 1..121 | 664 | 97.5 | Plus |
| CG32817-PC | 121 | CG32817-PC | 1..121 | 1..121 | 664 | 97.5 | Plus |
| CG32817-PA | 121 | CG32817-PA | 1..121 | 1..121 | 664 | 97.5 | Plus |
