Clone BS29548 Report

Search the DGRC for BS29548

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:295
Well:48
Vector:pDNR-Dual
Associated Gene/TranscriptCG32726-RA
Protein status:BS29548.pep: full length peptide match
Sequenced Size:215

Clone Sequence Records

BS29548.complete Sequence

215 bp assembled on 2012-05-25

GenBank Submission: KX803545

> BS29548.complete
GAAGTTATCAGTCGACATGCGTTTCTGTCTACTGTTCCTTTTGGCCATGA
GCTGCTGTCTGCTGCAATTCTCCGTGGCTGGAGTGAATTTGGTGCGCGGA
CTGGAGGCTGCCGGTCATCATCGCAACTTCACCGGCTCACCACCACCGCG
TGGTGCTCCTCCACCACCTCGGACCACCACCGCCAGTTCTTCGGGTTAAA
AGCTTTCTAGACCAT

BS29548.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:29:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG32726-RB 183 CG32726-PB 1..183 17..199 915 100 Plus
CG32726-RA 183 CG32726-PA 1..183 17..199 915 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:29:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG32726-RB 317 CG32726-RB 18..201 17..200 920 100 Plus
CG32726-RA 458 CG32726-RA 18..201 17..200 920 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:29:29
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7425477..7425613 200..64 685 100 Minus
X 23542271 X 7425679..7425726 64..17 240 100 Minus
Blast to na_te.dros performed on 2014-11-28 11:29:29 has no hits.

BS29548.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-05-25 09:30:18 Download gff for BS29548.complete
Subject Subject Range Query Range Percent Splice Strand
CG32726-RA 18..198 17..197 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:47 Download gff for BS29548.complete
Subject Subject Range Query Range Percent Splice Strand
CG32726-RA 18..198 17..197 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:44:51 Download gff for BS29548.complete
Subject Subject Range Query Range Percent Splice Strand
CG32726-RA 18..198 17..197 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:44:51 Download gff for BS29548.complete
Subject Subject Range Query Range Percent Splice Strand
X 7425480..7425612 65..197 100 <- Minus
X 7425679..7425726 17..64 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:47 Download gff for BS29548.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7319513..7319645 65..197 100 <- Minus
arm_X 7319712..7319759 17..64 100   Minus

BS29548.pep Sequence

Translation from 16 to 198

> BS29548.pep
MRFCLLFLLAMSCCLLQFSVAGVNLVRGLEAAGHHRNFTGSPPPRGAPPP
PRTTTASSSG*

BS29548.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:00:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG32726-PB 60 CG32726-PB 1..60 1..60 321 100 Plus
CG32726-PA 60 CG32726-PA 1..60 1..60 321 100 Plus