Clone BS29694 Report

Search the DGRC for BS29694

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:296
Well:94
Vector:pDNR-Dual
Associated Gene/TranscriptCG12355-RA
Protein status:BS29694.pep: full length peptide match
Sequenced Size:308

Clone Sequence Records

BS29694.complete Sequence

308 bp assembled on 2012-05-25

GenBank Submission: KX805296

> BS29694.complete
GAAGTTATCAGTCGACATGTCCATCATGGAGGGCTCTGCGGATATTTTCC
TGGAACTCCGCGAAAAATTCGTGCCGACTTTTATGCGTTCCTGCATTTTC
TGGTTGCCCGCGCAGGCCTTGAACTTTTCCCTGGTTGCACCCCGATTCCG
TGTCATCTATATGGGTATTTGTGGATTGATTTGGGTGAATATTCTATGTT
GGACCAAGCGGCAAAGTCTTCCAGTCGCAACGAAAGAAATTGCAACTGAT
TCAAATAATAATGCAGCTGCCATAAGGAATTCCGAAACATGAAAGCTTTC
TAGACCAT

BS29694.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:31:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG12355-RE 615 CG12355-PE 339..615 16..292 1385 100 Plus
CG12355-RB 615 CG12355-PB 339..615 16..292 1385 100 Plus
CG12355-RD 276 CG12355-PD 1..276 17..292 1380 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:31:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG12355-RE 1026 CG12355-RE 661..937 16..292 1385 100 Plus
CG12355-RD 791 CG12355-RD 426..702 16..292 1385 100 Plus
CG12355-RB 817 CG12355-RB 452..728 16..292 1385 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:31:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15493053..15493329 292..16 1385 100 Minus
Blast to na_te.dros performed on 2014-11-28 11:31:14 has no hits.

BS29694.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-05-25 09:30:38 Download gff for BS29694.complete
Subject Subject Range Query Range Percent Splice Strand
CG12355-RD 427..701 17..291 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:25:45 Download gff for BS29694.complete
Subject Subject Range Query Range Percent Splice Strand
CG12355-RB 453..727 17..291 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:45:39 Download gff for BS29694.complete
Subject Subject Range Query Range Percent Splice Strand
CG12355-RB 453..727 17..291 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:45:39 Download gff for BS29694.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15493054..15493328 17..291 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:25:45 Download gff for BS29694.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15486154..15486428 17..291 100   Minus

BS29694.pep Sequence

Translation from 16 to 291

> BS29694.pep
MSIMEGSADIFLELREKFVPTFMRSCIFWLPAQALNFSLVAPRFRVIYMG
ICGLIWVNILCWTKRQSLPVATKEIATDSNNNAAAIRNSET*

BS29694.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:00:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG12355-PD 91 CG12355-PD 1..91 1..91 474 100 Plus
CG12355-PA 91 CG12355-PA 1..91 1..91 474 100 Plus
CG12355-PE 204 CG12355-PE 114..204 1..91 474 100 Plus
CG12355-PB 204 CG12355-PB 114..204 1..91 474 100 Plus