BS29694.complete Sequence
308 bp assembled on 2012-05-25
GenBank Submission: KX805296
> BS29694.complete
GAAGTTATCAGTCGACATGTCCATCATGGAGGGCTCTGCGGATATTTTCC
TGGAACTCCGCGAAAAATTCGTGCCGACTTTTATGCGTTCCTGCATTTTC
TGGTTGCCCGCGCAGGCCTTGAACTTTTCCCTGGTTGCACCCCGATTCCG
TGTCATCTATATGGGTATTTGTGGATTGATTTGGGTGAATATTCTATGTT
GGACCAAGCGGCAAAGTCTTCCAGTCGCAACGAAAGAAATTGCAACTGAT
TCAAATAATAATGCAGCTGCCATAAGGAATTCCGAAACATGAAAGCTTTC
TAGACCAT
BS29694.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:31:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12355-RE | 615 | CG12355-PE | 339..615 | 16..292 | 1385 | 100 | Plus |
CG12355-RB | 615 | CG12355-PB | 339..615 | 16..292 | 1385 | 100 | Plus |
CG12355-RD | 276 | CG12355-PD | 1..276 | 17..292 | 1380 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:31:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12355-RE | 1026 | CG12355-RE | 661..937 | 16..292 | 1385 | 100 | Plus |
CG12355-RD | 791 | CG12355-RD | 426..702 | 16..292 | 1385 | 100 | Plus |
CG12355-RB | 817 | CG12355-RB | 452..728 | 16..292 | 1385 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:31:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 15493053..15493329 | 292..16 | 1385 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 11:31:14 has no hits.
BS29694.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-05-25 09:30:38 Download gff for
BS29694.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12355-RD | 427..701 | 17..291 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:25:45 Download gff for
BS29694.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12355-RB | 453..727 | 17..291 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:45:39 Download gff for
BS29694.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12355-RB | 453..727 | 17..291 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:45:39 Download gff for
BS29694.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15493054..15493328 | 17..291 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:25:45 Download gff for
BS29694.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 15486154..15486428 | 17..291 | 100 | | Minus |
BS29694.pep Sequence
Translation from 16 to 291
> BS29694.pep
MSIMEGSADIFLELREKFVPTFMRSCIFWLPAQALNFSLVAPRFRVIYMG
ICGLIWVNILCWTKRQSLPVATKEIATDSNNNAAAIRNSET*
BS29694.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:00:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12355-PD | 91 | CG12355-PD | 1..91 | 1..91 | 474 | 100 | Plus |
CG12355-PA | 91 | CG12355-PA | 1..91 | 1..91 | 474 | 100 | Plus |
CG12355-PE | 204 | CG12355-PE | 114..204 | 1..91 | 474 | 100 | Plus |
CG12355-PB | 204 | CG12355-PB | 114..204 | 1..91 | 474 | 100 | Plus |