BS29908.complete Sequence
407 bp assembled on 2012-05-24
GenBank Submission: KX802589
> BS29908.complete
GAAGTTATCAGTCGACATGCTTTTCGATGGCGCAGCCGGCAATAGGCAGG
GTCAGGGCCAGAATGCCCTGAAGCCATTGGTACAAGGCCAGGAGGAGCCC
GCCCTATGCGAGCAGTACTATCTGCTTGGCGATGGTTCCATCGTTCTGCG
CAACCTTCGCACCGACTTGTCCAATCCGCGCCTGGAGAGAGTGAAATCGC
GCTGCTGCCAGCGCCAAACGCTCATCCACGACATATGCGTCAACTGCGTG
ATGGATCTCTGCGAGGAGTGTGGCTACTCCTGCGGCGAGTGCTCCAGGTT
CATTTGCCGCAGCTGCGTGACTTTATTTGGTAATCGAGTTGAAGAAGAGA
AGGATCCCCTGTGCGAGCACTGCCAGATGTTCTTCAGCTAAAAGCTTTCT
AGACCAT
BS29908.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:28:23
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG13373-RB | 534 | CG13373-PB | 160..534 | 17..391 | 1875 | 100 | Plus |
| CG13373-RA | 375 | CG13373-PA | 1..375 | 17..391 | 1875 | 100 | Plus |
| CG3176-RD | 366 | CG3176-PD | 1..365 | 17..390 | 1280 | 90.1 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:28:24
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG13373-RB | 812 | CG13373-RB | 323..697 | 17..391 | 1875 | 100 | Plus |
| CG13373-RA | 743 | CG13373-RA | 254..628 | 17..391 | 1875 | 100 | Plus |
| CG3176-RD | 627 | CG3176-RD | 75..439 | 17..390 | 1280 | 90.1 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:28:21
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| X | 23542271 | X | 477621..477931 | 17..327 | 1555 | 100 | Plus |
| X | 23542271 | X | 479644..479945 | 17..327 | 1040 | 89.7 | Plus |
| X | 23542271 | X | 482132..482433 | 17..327 | 1025 | 89.4 | Plus |
| X | 23542271 | X | 478013..478076 | 328..391 | 320 | 100 | Plus |
| X | 23542271 | X | 482518..482580 | 328..390 | 255 | 93.7 | Plus |
| X | 23542271 | X | 480030..480092 | 328..390 | 240 | 92.1 | Plus |
Blast to na_te.dros performed on 2014-11-28 11:28:22 has no hits.
BS29908.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-05-24 16:57:06 Download gff for
BS29908.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG13373-RB | 160..532 | 17..389 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:09 Download gff for
BS29908.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG13373-RA | 254..626 | 17..389 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:44:13 Download gff for
BS29908.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG13373-RA | 254..626 | 17..389 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:44:13 Download gff for
BS29908.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| X | 477621..477931 | 17..327 | 100 | -> | Plus |
| X | 478013..478074 | 328..389 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:09 Download gff for
BS29908.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_X | 371654..371964 | 17..327 | 100 | -> | Plus |
| arm_X | 372046..372107 | 328..389 | 100 | | Plus |
BS29908.pep Sequence
Translation from 16 to 390
> BS29908.pep
MLFDGAAGNRQGQGQNALKPLVQGQEEPALCEQYYLLGDGSIVLRNLRTD
LSNPRLERVKSRCCQRQTLIHDICVNCVMDLCEECGYSCGECSRFICRSC
VTLFGNRVEEEKDPLCEHCQMFFS*
BS29908.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:59:43
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG13373-PA | 124 | CG13373-PA | 1..124 | 1..124 | 683 | 100 | Plus |
| CG13373-PB | 177 | CG13373-PB | 54..177 | 1..124 | 683 | 100 | Plus |
| CG3176-PD | 121 | CG3176-PD | 1..121 | 1..124 | 557 | 81.5 | Plus |
| CG3176-PA | 121 | CG3176-PA | 1..121 | 1..124 | 557 | 81.5 | Plus |
| CG32817-PB | 121 | CG32817-PB | 1..121 | 1..124 | 549 | 80.6 | Plus |
