BS29909.complete Sequence
305 bp assembled on 2012-05-24
GenBank Submission: KX803681
> BS29909.complete
GAAGTTATCAGTCGACATGTCTGACGAAAAGAAGGGAGGTGAGACCGAGC
ACATCAACCTGAAGGTCCTCGGCCAGGACAACGCCGTCGTCCAGTTCAAG
ATCAAGAAGCACACACCCTTGAGGAAGCTGATGAACGCCTACTGCGACCG
TGCCGGACTCTCCATGCAGGTGGTGCGCTTCCGTTTCGACGGACAGCCCA
TCAACGAGAACGACACTCCGACCTCGCTGGAGATGGAGGAGGGCGACACC
ATCGAGGTTTACCAGCAGCAGACTGGTGGCGCTCCATAAAAGCTTTCTAG
ACCAT
BS29909.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:28:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
smt3-RB | 273 | CG4494-PB | 1..273 | 17..289 | 1365 | 100 | Plus |
smt3-RA | 273 | CG4494-PA | 1..273 | 17..289 | 1365 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:28:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
smt3-RB | 689 | CG4494-RB | 167..441 | 15..289 | 1375 | 100 | Plus |
smt3-RA | 743 | CG4494-RA | 221..495 | 15..289 | 1375 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:28:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 6967028..6967302 | 289..15 | 1375 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 11:28:26 has no hits.
BS29909.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-05-24 16:57:06 Download gff for
BS29909.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
smt3-RA | 172..442 | 17..287 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:10 Download gff for
BS29909.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
smt3-RA | 223..493 | 17..287 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:44:15 Download gff for
BS29909.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
smt3-RA | 223..493 | 17..287 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:44:15 Download gff for
BS29909.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 6967030..6967300 | 17..287 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:10 Download gff for
BS29909.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 6967030..6967300 | 17..287 | 100 | | Minus |
BS29909.pep Sequence
Translation from 16 to 288
> BS29909.pep
MSDEKKGGETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSM
QVVRFRFDGQPINENDTPTSLEMEEGDTIEVYQQQTGGAP*
BS29909.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:59:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
smt3-PB | 90 | CG4494-PB | 1..90 | 1..90 | 471 | 100 | Plus |
smt3-PA | 90 | CG4494-PA | 1..90 | 1..90 | 471 | 100 | Plus |