Clone BS29909 Report

Search the DGRC for BS29909

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:299
Well:9
Vector:pDNR-Dual
Associated Gene/Transcriptsmt3-RA
Protein status:BS29909.pep: full length peptide match
Sequenced Size:305

Clone Sequence Records

BS29909.complete Sequence

305 bp assembled on 2012-05-24

GenBank Submission: KX803681

> BS29909.complete
GAAGTTATCAGTCGACATGTCTGACGAAAAGAAGGGAGGTGAGACCGAGC
ACATCAACCTGAAGGTCCTCGGCCAGGACAACGCCGTCGTCCAGTTCAAG
ATCAAGAAGCACACACCCTTGAGGAAGCTGATGAACGCCTACTGCGACCG
TGCCGGACTCTCCATGCAGGTGGTGCGCTTCCGTTTCGACGGACAGCCCA
TCAACGAGAACGACACTCCGACCTCGCTGGAGATGGAGGAGGGCGACACC
ATCGAGGTTTACCAGCAGCAGACTGGTGGCGCTCCATAAAAGCTTTCTAG
ACCAT

BS29909.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:28:27
Subject Length Description Subject Range Query Range Score Percent Strand
smt3-RB 273 CG4494-PB 1..273 17..289 1365 100 Plus
smt3-RA 273 CG4494-PA 1..273 17..289 1365 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:28:28
Subject Length Description Subject Range Query Range Score Percent Strand
smt3-RB 689 CG4494-RB 167..441 15..289 1375 100 Plus
smt3-RA 743 CG4494-RA 221..495 15..289 1375 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:28:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6967028..6967302 289..15 1375 100 Minus
Blast to na_te.dros performed on 2014-11-28 11:28:26 has no hits.

BS29909.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-05-24 16:57:06 Download gff for BS29909.complete
Subject Subject Range Query Range Percent Splice Strand
smt3-RA 172..442 17..287 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:10 Download gff for BS29909.complete
Subject Subject Range Query Range Percent Splice Strand
smt3-RA 223..493 17..287 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:44:15 Download gff for BS29909.complete
Subject Subject Range Query Range Percent Splice Strand
smt3-RA 223..493 17..287 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:44:15 Download gff for BS29909.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6967030..6967300 17..287 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:10 Download gff for BS29909.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6967030..6967300 17..287 100   Minus

BS29909.pep Sequence

Translation from 16 to 288

> BS29909.pep
MSDEKKGGETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSM
QVVRFRFDGQPINENDTPTSLEMEEGDTIEVYQQQTGGAP*

BS29909.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:59:45
Subject Length Description Subject Range Query Range Score Percent Strand
smt3-PB 90 CG4494-PB 1..90 1..90 471 100 Plus
smt3-PA 90 CG4494-PA 1..90 1..90 471 100 Plus