Clone BS29910 Report

Search the DGRC for BS29910

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:299
Well:10
Vector:pDNR-Dual
Associated Gene/TranscriptCG1368-RA
Protein status:BS29910.pep: full length peptide match
Sequenced Size:648

Clone Sequence Records

BS29910.complete Sequence

648 bp assembled on 2012-05-24

GenBank Submission: KX806083

> BS29910.complete
GGGAAGGGCGGAGGGAAGCGCGGCCCGCCTATCTTTCGTATAGCATATCT
TATACGAAGTTATCAGTCGACATGAAATTCCTTATTGCCTTCGCCCTGTT
CGCCTGCGTGGCCGCCGATGTTAGCCACCTGAGCAACGAGTACCTGCCCC
CCGTCCAGAGCTCGTACGCCGCTCCCTCGGTGAGCTACTCCGCACCAGCC
GTGCAGCAGACCTACGCCGCTCCAGCCATCCAGCAGTCGTATGTCGCCCC
CAGCAACGAGTACCTGCCTCCTGTGCAGACCTACTCCGCACCGGCCGTCC
AGAGGACCTACTCCGCACCAGCTGTCCAGAGGACCTACTCCGCCCCCTCT
GTTAGCTACTCGGCACCCTCTGTGAGCTACTCGGCTCCATCGGTCAGCTA
CTCCGCTCCTGCTGTCCAGCAGTCGTACTCCGCTCCATCGGTCAGCTACT
CCGCCCCTGCTGTCCAGCAGTCGTACTCCGCTCCATCGGTCAGCTACTCC
GCCCCTGCTGTCCAGCAGTCGTACTCCGCTCCTGCCGTCAGCTACTCCGC
CCCATCGGTGAGCTACTCCGCACCCTCCGTGGATGTGGGCACCCAGTACG
CCTCCAACGGTGGCTACGTCTACAGGAAGTAGAAGCTTTCTAGACCAT

BS29910.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:28:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG1368-RA 561 CG1368-PA 1..561 72..632 2790 99.8 Plus
CG1368-RA 561 CG1368-PA 307..434 426..553 565 96.1 Plus
CG1368-RA 561 CG1368-PA 355..482 378..505 565 96.1 Plus
CG1368-RA 561 CG1368-PA 307..386 474..553 325 93.8 Plus
CG1368-RA 561 CG1368-PA 403..482 378..457 325 93.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:28:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG1368-RA 774 CG1368-RA 72..632 72..632 2790 99.8 Plus
CG1368-RA 774 CG1368-RA 378..505 426..553 565 96.1 Plus
CG1368-RA 774 CG1368-RA 426..553 378..505 565 96.1 Plus
CG1368-RA 774 CG1368-RA 378..457 474..553 325 93.8 Plus
CG1368-RA 774 CG1368-RA 474..553 378..457 325 93.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:28:17
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 14174970..14175528 74..632 2780 99.8 Plus
X 23542271 X 14175274..14175401 426..553 565 96.1 Plus
X 23542271 X 14175322..14175449 378..505 565 96.1 Plus
X 23542271 X 14175274..14175353 474..553 325 93.8 Plus
X 23542271 X 14175370..14175449 378..457 325 93.8 Plus
Blast to na_te.dros performed on 2014-11-28 11:28:18 has no hits.

BS29910.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-05-24 16:57:05 Download gff for BS29910.complete
Subject Subject Range Query Range Percent Splice Strand
CG1368-RA 62..627 67..632 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:06 Download gff for BS29910.complete
Subject Subject Range Query Range Percent Splice Strand
CG1368-RA 67..632 67..632 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:44:10 Download gff for BS29910.complete
Subject Subject Range Query Range Percent Splice Strand
CG1368-RA 67..632 67..632 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:44:10 Download gff for BS29910.complete
Subject Subject Range Query Range Percent Splice Strand
X 14174968..14175528 71..632 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:06 Download gff for BS29910.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 14069001..14069561 71..632 99   Plus

BS29910.pep Sequence

Translation from 71 to 631

> BS29910.pep
MKFLIAFALFACVAADVSHLSNEYLPPVQSSYAAPSVSYSAPAVQQTYAA
PAIQQSYVAPSNEYLPPVQTYSAPAVQRTYSAPAVQRTYSAPSVSYSAPS
VSYSAPSVSYSAPAVQQSYSAPSVSYSAPAVQQSYSAPSVSYSAPAVQQS
YSAPAVSYSAPSVSYSAPSVDVGTQYASNGGYVYRK*

BS29910.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:59:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG1368-PA 186 CG1368-PA 1..186 1..186 932 100 Plus
CG32603-PA 345 CG32603-PA 156..345 14..184 389 51.8 Plus
CG32603-PA 345 CG32603-PA 1..244 1..174 343 44.3 Plus
CG11350-PC 456 CG11350-PC 1..161 1..178 343 50.8 Plus
CG34205-PA 217 CG34205-PA 23..212 1..173 311 39.9 Plus
CG11350-PC 456 CG11350-PC 220..444 21..185 306 40.3 Plus
CG11350-PC 456 CG11350-PC 108..302 31..185 282 42.2 Plus
CG11585-PB 342 CG11585-PB 100..298 14..181 280 46.1 Plus
CG11350-PC 456 CG11350-PC 315..437 16..139 261 53.8 Plus