Clone BS29913 Report

Search the DGRC for BS29913

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:299
Well:13
Vector:pDNR-Dual
Associated Gene/TranscriptCG1943-RA
Protein status:BS29913.pep: full length peptide match
Sequenced Size:389

Clone Sequence Records

BS29913.complete Sequence

389 bp assembled on 2012-05-24

GenBank Submission: KX802488

> BS29913.complete
GAAGTTATCAGTCGACATGACATCCACCGAGCTGAAAATCGGCCTGACCA
CCAGTGCCCGTCCCTCCAGCCGAGTGCTGAAGCCCCCAGGCGGCGGACAC
ACCAATATCTTCTCGGAGCCCGACGTGGCCGTTCCCGCCCCGCGTGCCAA
GTACAACCAACAGAACTCCTCAAACCTCAATGCCTGCATGGGCTCCACGG
ATCCCAACAAGGTGGTGGAGAAAATTCGCGAAGAGGTCTCCATCCAGAAG
GAGGAGGCCAAGTCCGCCCCACCCAGCCAGCCCAAGGAGCCGGCGAACAA
ACCAGCGGCCACAAATGGAGAGGCACGCGGCCGAGTTCCACCCGGCGGAT
TCTCGTCGGGCGGATTCTGGTAGAAGCTTTCTAGACCAT

BS29913.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:26:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG1943-RD 357 CG1943-PD 1..357 17..373 1785 100 Plus
CG1943-RC 357 CG1943-PC 1..357 17..373 1785 100 Plus
CG1943-RB 357 CG1943-PB 1..357 17..373 1785 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:26:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG1943-RD 1207 CG1943-RD 145..502 17..374 1790 100 Plus
CG1943-RC 985 CG1943-RC 113..470 17..374 1790 100 Plus
CG1943-RB 991 CG1943-RB 119..476 17..374 1790 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:26:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7076919..7077276 17..374 1790 100 Plus
Blast to na_te.dros performed on 2014-11-28 11:26:13 has no hits.

BS29913.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-05-24 16:56:43 Download gff for BS29913.complete
Subject Subject Range Query Range Percent Splice Strand
CG1943-RA 167..523 17..373 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:23:00 Download gff for BS29913.complete
Subject Subject Range Query Range Percent Splice Strand
CG1943-RB 119..475 17..373 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:43:11 Download gff for BS29913.complete
Subject Subject Range Query Range Percent Splice Strand
CG1943-RB 119..475 17..373 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:43:11 Download gff for BS29913.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7076919..7077275 17..373 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:23:00 Download gff for BS29913.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2902641..2902997 17..373 100   Plus

BS29913.pep Sequence

Translation from 16 to 372

> BS29913.pep
MTSTELKIGLTTSARPSSRVLKPPGGGHTNIFSEPDVAVPAPRAKYNQQN
SSNLNACMGSTDPNKVVEKIREEVSIQKEEAKSAPPSQPKEPANKPAATN
GEARGRVPPGGFSSGGFW*

BS29913.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:38:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG1943-PD 118 CG1943-PD 1..118 1..118 618 100 Plus
CG1943-PC 118 CG1943-PC 1..118 1..118 618 100 Plus
CG1943-PB 118 CG1943-PB 1..118 1..118 618 100 Plus
CG1943-PA 118 CG1943-PA 1..118 1..118 618 100 Plus