BS29915.complete Sequence
245 bp assembled on 2012-05-24
GenBank Submission: KX804268
> BS29915.complete
GAAGTTATCAGTCGACATGGACGTAATGTCATCATCCCTGCAGCAGCAGC
GCGTCGTGGTGGAGCAGCTGCGTCGCGAGGCTGCCATCGACCGCCAGACG
ATCTCGGAGTCATGCGCTAAGATGATGAAGTACATCACGGAGCACGAGCA
GGAGGACTACCTGCTCACCGGGTTCACCAGCCAGAAGGTGAATCCCTTCC
GCGAGAAGTCGTCCTGCACCGTTCTCTAAAAGCTTTCTAGACCAT
BS29915.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:26:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ggamma1-RC | 213 | CG8261-PC | 1..213 | 17..229 | 1065 | 100 | Plus |
Ggamma1-RB | 213 | CG8261-PB | 1..213 | 17..229 | 1065 | 100 | Plus |
Ggamma1-RA | 213 | CG8261-PA | 1..213 | 17..229 | 1065 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:26:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ggamma1-RC | 831 | CG8261-RC | 48..261 | 16..229 | 1070 | 100 | Plus |
Ggamma1-RB | 1084 | CG8261-RB | 301..514 | 16..229 | 1070 | 100 | Plus |
Ggamma1-RA | 2554 | CG8261-RA | 110..323 | 16..229 | 1070 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:26:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 8902347..8902560 | 16..229 | 1070 | 100 | Plus |
Blast to na_te.dros performed 2014-11-28 11:26:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\ninja | 6644 | Dsim\ninja DSRN 6644bp Derived from D83207 (Rel. 53, Last updated, Version 4). | 1526..1564 | 32..72 | 101 | 75.6 | Plus |
BS29915.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-05-24 16:56:44 Download gff for
BS29915.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ggamma1-RB | 332..542 | 17..227 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:23:04 Download gff for
BS29915.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ggamma1-RA | 111..321 | 17..227 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:43:15 Download gff for
BS29915.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ggamma1-RA | 111..321 | 17..227 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:43:15 Download gff for
BS29915.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8902348..8902558 | 17..227 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:23:04 Download gff for
BS29915.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 4789853..4790063 | 17..227 | 100 | | Plus |
BS29915.pep Sequence
Translation from 16 to 228
> BS29915.pep
MDVMSSSLQQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLL
TGFTSQKVNPFREKSSCTVL*
BS29915.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:38:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ggamma1-PC | 70 | CG8261-PC | 1..70 | 1..70 | 349 | 100 | Plus |
Ggamma1-PB | 70 | CG8261-PB | 1..70 | 1..70 | 349 | 100 | Plus |
Ggamma1-PA | 70 | CG8261-PA | 1..70 | 1..70 | 349 | 100 | Plus |
CG43324-PA | 66 | CG43324-PA | 1..66 | 4..70 | 209 | 61.2 | Plus |