Clone BS29915 Report

Search the DGRC for BS29915

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:299
Well:15
Vector:pDNR-Dual
Associated Gene/TranscriptGgamma1-RA
Protein status:BS29915.pep: full length peptide match
Sequenced Size:245

Clone Sequence Records

BS29915.complete Sequence

245 bp assembled on 2012-05-24

GenBank Submission: KX804268

> BS29915.complete
GAAGTTATCAGTCGACATGGACGTAATGTCATCATCCCTGCAGCAGCAGC
GCGTCGTGGTGGAGCAGCTGCGTCGCGAGGCTGCCATCGACCGCCAGACG
ATCTCGGAGTCATGCGCTAAGATGATGAAGTACATCACGGAGCACGAGCA
GGAGGACTACCTGCTCACCGGGTTCACCAGCCAGAAGGTGAATCCCTTCC
GCGAGAAGTCGTCCTGCACCGTTCTCTAAAAGCTTTCTAGACCAT

BS29915.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:26:22
Subject Length Description Subject Range Query Range Score Percent Strand
Ggamma1-RC 213 CG8261-PC 1..213 17..229 1065 100 Plus
Ggamma1-RB 213 CG8261-PB 1..213 17..229 1065 100 Plus
Ggamma1-RA 213 CG8261-PA 1..213 17..229 1065 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:26:23
Subject Length Description Subject Range Query Range Score Percent Strand
Ggamma1-RC 831 CG8261-RC 48..261 16..229 1070 100 Plus
Ggamma1-RB 1084 CG8261-RB 301..514 16..229 1070 100 Plus
Ggamma1-RA 2554 CG8261-RA 110..323 16..229 1070 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:26:20
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8902347..8902560 16..229 1070 100 Plus
Blast to na_te.dros performed 2014-11-28 11:26:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\ninja 6644 Dsim\ninja DSRN 6644bp Derived from D83207 (Rel. 53, Last updated, Version 4). 1526..1564 32..72 101 75.6 Plus

BS29915.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-05-24 16:56:44 Download gff for BS29915.complete
Subject Subject Range Query Range Percent Splice Strand
Ggamma1-RB 332..542 17..227 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:23:04 Download gff for BS29915.complete
Subject Subject Range Query Range Percent Splice Strand
Ggamma1-RA 111..321 17..227 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:43:15 Download gff for BS29915.complete
Subject Subject Range Query Range Percent Splice Strand
Ggamma1-RA 111..321 17..227 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:43:15 Download gff for BS29915.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8902348..8902558 17..227 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:23:04 Download gff for BS29915.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4789853..4790063 17..227 100   Plus

BS29915.pep Sequence

Translation from 16 to 228

> BS29915.pep
MDVMSSSLQQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLL
TGFTSQKVNPFREKSSCTVL*

BS29915.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:38:04
Subject Length Description Subject Range Query Range Score Percent Strand
Ggamma1-PC 70 CG8261-PC 1..70 1..70 349 100 Plus
Ggamma1-PB 70 CG8261-PB 1..70 1..70 349 100 Plus
Ggamma1-PA 70 CG8261-PA 1..70 1..70 349 100 Plus
CG43324-PA 66 CG43324-PA 1..66 4..70 209 61.2 Plus