BS30020.complete Sequence
257 bp assembled on 2012-05-24
GenBank Submission: KX804446
> BS30020.complete
GAAGTTATCAGTCGACATGAGCAAGGACATTTACTACTCCGACAAGTACT
ACGATGAGCAGTTCGAGTACAGACATGTGGTTTTGCCAAAAGAGCTGGTA
AAAATGGTGCCCAAGACTCATCTGATGACGGAGGCCGAGTGGCGATCAAT
TGGCGTACAGCAGTCGCGCGGATGGATCCACTACATGATCCATAAGCCGG
AGCCCCACATCCTCCTGTTTCGGCGACCCAAAACGGATTAGAAGCTTTCT
AGACCAT
BS30020.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:28:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Cks30A-RA | 225 | CG3738-PA | 1..225 | 17..241 | 1125 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:28:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Cks30A-RA | 1147 | CG3738-RA | 293..518 | 17..242 | 1130 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:28:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 9331179..9331352 | 69..242 | 870 | 100 | Plus |
2L | 23513712 | 2L | 9331055..9331110 | 17..72 | 280 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 11:28:02 has no hits.
BS30020.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-05-24 16:57:02 Download gff for
BS30020.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Cks30A-RA | 289..513 | 17..241 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:23:59 Download gff for
BS30020.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Cks30A-RA | 293..517 | 17..241 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:44:01 Download gff for
BS30020.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Cks30A-RA | 293..517 | 17..241 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:44:01 Download gff for
BS30020.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 9331183..9331351 | 73..241 | 100 | | Plus |
2L | 9331055..9331110 | 17..72 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:23:59 Download gff for
BS30020.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 9331183..9331351 | 73..241 | 100 | | Plus |
arm_2L | 9331055..9331110 | 17..72 | 100 | -> | Plus |
BS30020.pep Sequence
Translation from 16 to 240
> BS30020.pep
MSKDIYYSDKYYDEQFEYRHVVLPKELVKMVPKTHLMTEAEWRSIGVQQS
RGWIHYMIHKPEPHILLFRRPKTD*
BS30020.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:59:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Cks30A-PA | 74 | CG3738-PA | 1..74 | 1..74 | 407 | 100 | Plus |
Cks85A-PC | 96 | CG9790-PC | 6..73 | 5..72 | 288 | 67.6 | Plus |
Cks85A-PB | 96 | CG9790-PB | 6..73 | 5..72 | 288 | 67.6 | Plus |
Cks85A-PA | 96 | CG9790-PA | 6..73 | 5..72 | 288 | 67.6 | Plus |