Clone BS30020 Report

Search the DGRC for BS30020

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:300
Well:20
Vector:pDNR-Dual
Associated Gene/TranscriptCks30A-RA
Protein status:BS30020.pep: full length peptide match
Sequenced Size:257

Clone Sequence Records

BS30020.complete Sequence

257 bp assembled on 2012-05-24

GenBank Submission: KX804446

> BS30020.complete
GAAGTTATCAGTCGACATGAGCAAGGACATTTACTACTCCGACAAGTACT
ACGATGAGCAGTTCGAGTACAGACATGTGGTTTTGCCAAAAGAGCTGGTA
AAAATGGTGCCCAAGACTCATCTGATGACGGAGGCCGAGTGGCGATCAAT
TGGCGTACAGCAGTCGCGCGGATGGATCCACTACATGATCCATAAGCCGG
AGCCCCACATCCTCCTGTTTCGGCGACCCAAAACGGATTAGAAGCTTTCT
AGACCAT

BS30020.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:28:03
Subject Length Description Subject Range Query Range Score Percent Strand
Cks30A-RA 225 CG3738-PA 1..225 17..241 1125 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:28:04
Subject Length Description Subject Range Query Range Score Percent Strand
Cks30A-RA 1147 CG3738-RA 293..518 17..242 1130 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:28:01
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9331179..9331352 69..242 870 100 Plus
2L 23513712 2L 9331055..9331110 17..72 280 100 Plus
Blast to na_te.dros performed on 2014-11-28 11:28:02 has no hits.

BS30020.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-05-24 16:57:02 Download gff for BS30020.complete
Subject Subject Range Query Range Percent Splice Strand
Cks30A-RA 289..513 17..241 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:23:59 Download gff for BS30020.complete
Subject Subject Range Query Range Percent Splice Strand
Cks30A-RA 293..517 17..241 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:44:01 Download gff for BS30020.complete
Subject Subject Range Query Range Percent Splice Strand
Cks30A-RA 293..517 17..241 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:44:01 Download gff for BS30020.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9331183..9331351 73..241 100   Plus
2L 9331055..9331110 17..72 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:23:59 Download gff for BS30020.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9331183..9331351 73..241 100   Plus
arm_2L 9331055..9331110 17..72 100 -> Plus

BS30020.pep Sequence

Translation from 16 to 240

> BS30020.pep
MSKDIYYSDKYYDEQFEYRHVVLPKELVKMVPKTHLMTEAEWRSIGVQQS
RGWIHYMIHKPEPHILLFRRPKTD*

BS30020.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:59:36
Subject Length Description Subject Range Query Range Score Percent Strand
Cks30A-PA 74 CG3738-PA 1..74 1..74 407 100 Plus
Cks85A-PC 96 CG9790-PC 6..73 5..72 288 67.6 Plus
Cks85A-PB 96 CG9790-PB 6..73 5..72 288 67.6 Plus
Cks85A-PA 96 CG9790-PA 6..73 5..72 288 67.6 Plus