Clone BS30066 Report

Search the DGRC for BS30066

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:300
Well:66
Vector:pDNR-Dual
Associated Gene/TranscriptCG45049-RB
Protein status:BS30066.pep: full length peptide match
Sequenced Size:644

Clone Sequence Records

BS30066.complete Sequence

644 bp assembled on 2012-05-24

GenBank Submission: KX805738

> BS30066.complete
GAAGTTATCAGTCGACATGGCGCCGACCACGACGATTGAGACCATCACAA
TCACGAGGCCGCTGAAGGTGATTGCATTTATCTGCGGCGTCATCGTGGTG
GCCCTCATGATTATGGCTCTGGCGTCCACAGATTGGTTAATGGCCTCAGA
CTGGCGGCAAGGTCTCTTTGTGCACTGCATCGAGGATGATTCGGTGCCGC
CGCTGCCATTCAATATCCAGGATCCGCCAGGATGCTACTGGACCCGCGAT
GTCGGCTACATTAAGGCCACAGCCGCTCTGTGCATCATCACGCTGATAAC
GGACGTCATTGCCACAGTACTGACAGGTCTGGGCCTCCGGACGCAGAATC
ATAATCTAAAGTATAAGTTCTATCGTATAGCAGTATTGGTGATGCTTGTA
TCCTTGCTGGCCGTATTGTCCGCCTTGATCGTATATCCAGTATGCTTTGC
CGGCGAACTAACCATGGCCAATCGACGAGTCTGGGAATTTGGCTGGGCCT
ATGGCGTCGGCTGGGGTGCGGCCATCTTTCTATTTGGGGCCGTTGTCCTG
CTGCTCTGCGACAAGGAGTCGGAGGAGATCTACTATAAGGAAAGGAAAAT
CGTACATGAAAACCAAATGCGCGCCTAGAAGCTTTCTAGACCAT

BS30066.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:28:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG45049-RF 612 CG45049-PF 1..612 17..628 3060 100 Plus
CG45049-RE 822 CG45049-PE 211..822 17..628 3060 100 Plus
CG45049-RC 612 CG45049-PC 1..612 17..628 3060 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:28:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG45049-RF 1516 CG45049-RF 136..747 17..628 3060 100 Plus
CG45049-RE 3417 CG45049-RE 551..1162 17..628 3060 100 Plus
CG45049-RC 3708 CG45049-RC 842..1453 17..628 3060 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:28:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22729351..22729540 66..255 950 100 Plus
3R 32079331 3R 22729946..22730107 467..628 810 100 Plus
3R 32079331 3R 22729609..22729759 254..404 755 100 Plus
3R 32079331 3R 22729817..22729879 405..467 315 100 Plus
3R 32079331 3R 22729234..22729286 17..69 265 100 Plus
Blast to na_te.dros performed on 2014-11-28 11:28:06 has no hits.

BS30066.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-05-24 16:57:03 Download gff for BS30066.complete
Subject Subject Range Query Range Percent Splice Strand
CG6982-RB 450..1061 17..628 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:00 Download gff for BS30066.complete
Subject Subject Range Query Range Percent Splice Strand
CG17618-RC 842..1453 17..628 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:44:03 Download gff for BS30066.complete
Subject Subject Range Query Range Percent Splice Strand
CG45049-RC 842..1453 17..628 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:44:03 Download gff for BS30066.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22729234..22729284 17..67 100 -> Plus
3R 22729353..22729539 68..254 100 -> Plus
3R 22729610..22729759 255..404 100 -> Plus
3R 22729817..22729879 405..467 100 -> Plus
3R 22729947..22730107 468..628 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:00 Download gff for BS30066.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18555669..18555829 468..628 100   Plus
arm_3R 18554956..18555006 17..67 100 -> Plus
arm_3R 18555075..18555261 68..254 100 -> Plus
arm_3R 18555332..18555481 255..404 100 -> Plus
arm_3R 18555539..18555601 405..467 100 -> Plus

BS30066.pep Sequence

Translation from 16 to 627

> BS30066.pep
MAPTTTIETITITRPLKVIAFICGVIVVALMIMALASTDWLMASDWRQGL
FVHCIEDDSVPPLPFNIQDPPGCYWTRDVGYIKATAALCIITLITDVIAT
VLTGLGLRTQNHNLKYKFYRIAVLVMLVSLLAVLSALIVYPVCFAGELTM
ANRRVWEFGWAYGVGWGAAIFLFGAVVLLLCDKESEEIYYKERKIVHENQ
MRA*

BS30066.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:59:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG45049-PF 203 CG45049-PF 1..203 1..203 1061 100 Plus
CG45049-PC 203 CG45049-PC 1..203 1..203 1061 100 Plus
CG45049-PB 203 CG45049-PB 1..203 1..203 1061 100 Plus
CG45049-PE 273 CG45049-PE 71..273 1..203 1061 100 Plus
CG45049-PD 273 CG45049-PD 71..273 1..203 1061 100 Plus