Clone BS30701 Report

Search the DGRC for BS30701

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:307
Well:1
Vector:pDNR-Dual
Associated Gene/TranscriptCG13557-RA
Protein status:BS30701.pep: gold
Sequenced Size:344

Clone Sequence Records

BS30701.complete Sequence

344 bp assembled on 2012-07-10

GenBank Submission: KX803992

> BS30701.complete
GAAGTTATCAGTCGACATGGTCTCCAAGTGGCTGCGCATCTTGGTTCTAT
TTCTTCTGGGTCTTGCAACCTCGCGGGCCTCCCTATTTCGCTCCGAGTCG
CCGAAACCACAGTTGAGCTGGTGGCACAAACAGTACTACCAGTCGCTATG
GCAACAGAGGCTGCGGTTTACGACGACTCCCCGGCCAGGAGCCACTCCCG
AATCGGATGAAGCCAGATTGGTGTATCCCTGCTACTGCTACAAGCCAACT
CCCGAGGGCTTGGCCACTGCCAGTCCGGTGGAGCAGCGAATGATTGAGAC
CAAGGAAATATTCTTCTTGAACAAATAGAAGCTTTCTAGACCAT

BS30701.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:41:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG13557-RA 312 CG13557-PA 1..312 17..328 1560 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:41:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG13557-RA 436 CG13557-RA 10..321 17..328 1560 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:41:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23475813..23475991 328..150 895 100 Minus
2R 25286936 2R 23476276..23476409 150..17 670 100 Minus
Blast to na_te.dros performed on 2014-11-28 11:41:29 has no hits.

BS30701.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-07-10 13:27:00 Download gff for BS30701.complete
Subject Subject Range Query Range Percent Splice Strand
CG13557-RA 10..315 17..322 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:30:02 Download gff for BS30701.complete
Subject Subject Range Query Range Percent Splice Strand
CG13557-RA 10..315 17..322 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:49:22 Download gff for BS30701.complete
Subject Subject Range Query Range Percent Splice Strand
CG13557-RA 10..315 17..322 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:49:22 Download gff for BS30701.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23475819..23475991 150..322 100 <- Minus
2R 23476277..23476409 17..149 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:30:02 Download gff for BS30701.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19363342..19363514 150..322 100 <- Minus
arm_2R 19363800..19363932 17..149 100   Minus

BS30701.pep Sequence

Translation from 16 to 327

> BS30701.pep
MVSKWLRILVLFLLGLATSRASLFRSESPKPQLSWWHKQYYQSLWQQRLR
FTTTPRPGATPESDEARLVYPCYCYKPTPEGLATASPVEQRMIETKEIFF
LNK*

BS30701.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:08:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG13557-PA 103 CG13557-PA 1..103 1..103 553 100 Plus