Clone BS30702 Report

Search the DGRC for BS30702

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:307
Well:2
Vector:pDNR-Dual
Associated Gene/TranscriptCG43107-RA
Protein status:BS30702.pep: full length peptide match
Sequenced Size:224

Clone Sequence Records

BS30702.complete Sequence

224 bp assembled on 2012-07-10

GenBank Submission: KX803395

> BS30702.complete
GAAGTTATCAGTCGACATGAACAGTTCCAAAAACGATGTCCGTTCTTCCT
TTAAATACGGGCCAGCTGTCCGGATCGGAATCGCCGTCCTGGTGCTCCAC
ACCGTCGGCTGGCTGGGTTGGAAGGCGGTGAACCAGGGTGCGGAATCCAA
GGAGGCAGCAGCGAAGGCCCAGCAAGAACAATTGCGAGCGGTATTCGCAG
AAAAGTGAAAGCTTTCTAGACCAT

BS30702.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:41:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG43107-RA 192 CG43107-PA 1..192 17..208 960 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:41:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG43107-RA 371 CG43107-RA 45..236 17..208 960 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:41:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17140630..17140821 208..17 960 100 Minus
Blast to na_te.dros performed on 2014-11-28 11:41:33 has no hits.

BS30702.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-07-10 13:27:01 Download gff for BS30702.complete
Subject Subject Range Query Range Percent Splice Strand
CG43107-RA 59..249 17..207 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:30:04 Download gff for BS30702.complete
Subject Subject Range Query Range Percent Splice Strand
CG43107-RA 59..249 17..207 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:49:23 Download gff for BS30702.complete
Subject Subject Range Query Range Percent Splice Strand
CG43107-RA 45..235 17..207 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:49:23 Download gff for BS30702.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17140631..17140821 17..207 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:30:04 Download gff for BS30702.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13028136..13028326 17..207 100   Minus

BS30702.pep Sequence

Translation from 16 to 207

> BS30702.pep
MNSSKNDVRSSFKYGPAVRIGIAVLVLHTVGWLGWKAVNQGAESKEAAAK
AQQEQLRAVFAEK*

BS30702.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:08:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG43107-PA 63 CG43107-PA 1..63 1..63 317 100 Plus