BS30705.complete Sequence
245 bp assembled on 2012-07-10
GenBank Submission: KX801484
> BS30705.complete
GAAGTTATCAGTCGACATGGTTCGACCAACACTAGTTGCGCTGGCTAAGC
GCGTACCGCTCATACACTTCCGCAAGGGTGGTGCAGGAGTGCCGGGCGCC
CAGACAGCAAACCAGAAGTTGGCCGGTGGACCAGCAATTGAGGACTATGA
GCTGCCGGCACGATTTGCCCGCAAGCCAATTGATCCCGAAGAGGCGGCTT
ACATTAATAATGGGGGTATTCCAAACTGAAAGCTTTCTAGACCAT
BS30705.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:41:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG44242-RA | 213 | CG44242-PA | 1..213 | 17..229 | 1050 | 99.5 | Plus |
CG44242-RB | 243 | CG44242-PB | 130..243 | 116..229 | 555 | 99.1 | Plus |
CG44242-RB | 243 | CG44242-PB | 1..102 | 17..118 | 510 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:41:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG44242-RA | 426 | CG44242-RA | 88..301 | 17..230 | 1055 | 99.5 | Plus |
CG44242-RB | 456 | CG44242-RB | 217..331 | 116..230 | 560 | 99.1 | Plus |
CG44242-RB | 456 | CG44242-RB | 88..189 | 17..118 | 510 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:41:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 16196690..16196803 | 117..230 | 555 | 99.1 | Plus |
2R | 25286936 | 2R | 16196471..16196572 | 17..118 | 510 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 11:41:38 has no hits.
BS30705.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-07-10 13:27:02 Download gff for
BS30705.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8446-RD | 86..297 | 17..228 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:30:06 Download gff for
BS30705.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG44242-RA | 88..299 | 17..228 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:49:25 Download gff for
BS30705.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG44242-RA | 88..299 | 17..228 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:49:25 Download gff for
BS30705.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 16196471..16196572 | 17..118 | 100 | -> | Plus |
2R | 16196692..16196801 | 119..228 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:30:06 Download gff for
BS30705.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 12083976..12084077 | 17..118 | 100 | -> | Plus |
arm_2R | 12084197..12084306 | 119..228 | 99 | | Plus |
BS30705.pep Sequence
Translation from 16 to 228
> BS30705.pep
MVRPTLVALAKRVPLIHFRKGGAGVPGAQTANQKLAGGPAIEDYELPARF
ARKPIDPEEAAYINNGGIPN*
BS30705.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:08:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG44242-PA | 70 | CG44242-PA | 1..70 | 1..70 | 364 | 100 | Plus |
CG44242-PB | 80 | CG44242-PB | 1..80 | 1..70 | 343 | 87.5 | Plus |