Clone BS30705 Report

Search the DGRC for BS30705

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:307
Well:5
Vector:pDNR-Dual
Associated Gene/TranscriptCG44242-RA
Protein status:BS30705.pep: full length peptide match
Sequenced Size:245

Clone Sequence Records

BS30705.complete Sequence

245 bp assembled on 2012-07-10

GenBank Submission: KX801484

> BS30705.complete
GAAGTTATCAGTCGACATGGTTCGACCAACACTAGTTGCGCTGGCTAAGC
GCGTACCGCTCATACACTTCCGCAAGGGTGGTGCAGGAGTGCCGGGCGCC
CAGACAGCAAACCAGAAGTTGGCCGGTGGACCAGCAATTGAGGACTATGA
GCTGCCGGCACGATTTGCCCGCAAGCCAATTGATCCCGAAGAGGCGGCTT
ACATTAATAATGGGGGTATTCCAAACTGAAAGCTTTCTAGACCAT

BS30705.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:41:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG44242-RA 213 CG44242-PA 1..213 17..229 1050 99.5 Plus
CG44242-RB 243 CG44242-PB 130..243 116..229 555 99.1 Plus
CG44242-RB 243 CG44242-PB 1..102 17..118 510 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:41:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG44242-RA 426 CG44242-RA 88..301 17..230 1055 99.5 Plus
CG44242-RB 456 CG44242-RB 217..331 116..230 560 99.1 Plus
CG44242-RB 456 CG44242-RB 88..189 17..118 510 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:41:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16196690..16196803 117..230 555 99.1 Plus
2R 25286936 2R 16196471..16196572 17..118 510 100 Plus
Blast to na_te.dros performed on 2014-11-28 11:41:38 has no hits.

BS30705.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-07-10 13:27:02 Download gff for BS30705.complete
Subject Subject Range Query Range Percent Splice Strand
CG8446-RD 86..297 17..228 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:30:06 Download gff for BS30705.complete
Subject Subject Range Query Range Percent Splice Strand
CG44242-RA 88..299 17..228 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:49:25 Download gff for BS30705.complete
Subject Subject Range Query Range Percent Splice Strand
CG44242-RA 88..299 17..228 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:49:25 Download gff for BS30705.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16196471..16196572 17..118 100 -> Plus
2R 16196692..16196801 119..228 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:30:06 Download gff for BS30705.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12083976..12084077 17..118 100 -> Plus
arm_2R 12084197..12084306 119..228 99   Plus

BS30705.pep Sequence

Translation from 16 to 228

> BS30705.pep
MVRPTLVALAKRVPLIHFRKGGAGVPGAQTANQKLAGGPAIEDYELPARF
ARKPIDPEEAAYINNGGIPN*

BS30705.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG44242-PA 70 CG44242-PA 1..70 1..70 364 100 Plus
CG44242-PB 80 CG44242-PB 1..80 1..70 343 87.5 Plus