BS31011.complete Sequence
368 bp assembled on 2012-07-12
GenBank Submission: KX802950
> BS31011.complete
GAAGTTATCAGTCGACATGGTGGCCGTTAAGAAACAAAAGAAGGCTCTGG
AGAGCACCAACGCCCGTCTGGCGCTGGTGATGAAGTCCGGCAAATACTGC
CTGGGCTACAAGCAGACCTTGAAGACCCTGCGCCAGGGCAAGGCCAAACT
GGTGCTCATCGCCAGCAACACGCCCGCCCTGAGGAAGTCCGAGATCGAGT
ACTACGCTATGCTGGCCAAGACTGAAGTCCAGCACTACAGCGGCACCAAC
ATCGAGCTGGGCACCGCCTGTGGTAAATACTTCCGCGTGTGCACCCTGTC
CATCACCGATCCTGGAGATTCGGACATCATCCGCTCGCTGGAGACGGCCT
AAAAGCTTTCTAGACCAT
BS31011.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:42:10
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| RpL30-RE | 336 | CG10652-PE | 1..336 | 17..352 | 1680 | 100 | Plus |
| RpL30-RB | 336 | CG10652-PB | 1..336 | 17..352 | 1680 | 100 | Plus |
| RpL30-RC | 336 | CG10652-PC | 1..336 | 17..352 | 1680 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:42:11
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| RpL30-RE | 735 | CG10652-RE | 54..392 | 15..353 | 1695 | 100 | Plus |
| RpL30-RB | 477 | CG10652-RB | 54..392 | 15..353 | 1695 | 100 | Plus |
| RpL30-RC | 602 | CG10652-RC | 123..461 | 15..353 | 1695 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:42:08
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2L | 23513712 | 2L | 19008374..19008545 | 353..182 | 860 | 100 | Minus |
| 2L | 23513712 | 2L | 19008948..19009117 | 184..15 | 850 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 11:42:09 has no hits.
BS31011.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-07-12 11:17:56 Download gff for
BS31011.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpL30-RC | 92..425 | 17..350 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:30:19 Download gff for
BS31011.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpL30-RC | 56..389 | 17..350 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:49:36 Download gff for
BS31011.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpL30-RC | 125..458 | 17..350 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:49:36 Download gff for
BS31011.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2L | 19008377..19008543 | 184..350 | 100 | <- | Minus |
| 2L | 19008949..19009115 | 17..183 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:30:19 Download gff for
BS31011.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2L | 19008377..19008543 | 184..350 | 100 | <- | Minus |
| arm_2L | 19008949..19009115 | 17..183 | 100 | | Minus |
BS31011.pep Sequence
Translation from 16 to 351
> BS31011.pep
MVAVKKQKKALESTNARLALVMKSGKYCLGYKQTLKTLRQGKAKLVLIAS
NTPALRKSEIEYYAMLAKTEVQHYSGTNIELGTACGKYFRVCTLSITDPG
DSDIIRSLETA*
BS31011.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:08:31
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| RpL30-PE | 111 | CG10652-PE | 1..111 | 1..111 | 556 | 100 | Plus |
| RpL30-PB | 111 | CG10652-PB | 1..111 | 1..111 | 556 | 100 | Plus |
| RpL30-PC | 111 | CG10652-PC | 1..111 | 1..111 | 556 | 100 | Plus |
