BS31166.complete Sequence
290 bp assembled on 2012-07-13
GenBank Submission: KX805911
> BS31166.complete
GAAGTTATCAGTCGACATGTCACAGCTGCGCTCGAAAGTCATTAGCCTCT
ACAAGCACTTGCAGTATTTGGGCCGCGAATATCCCGGCCTGAACGGGCCG
CAGAAGTTCAGGAAGCAGATCCACGATGCCTTCATGAACCACAAGGACGA
GCAGGATCCCAAGAAGATCGTCGCCCTGCTAGCCCAAGGACGTTACTTGG
CCAAGGAGGTGGAGGCCCTGTACTCGCTGAAGAAGTACCGAAGTGTCAAG
CAGCGCTATAGTTACAATGACTAAAAGCTTTCTAGACCAT
BS31166.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:44:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG6115-RB | 258 | CG6115-PB | 1..258 | 17..274 | 1290 | 100 | Plus |
CG6115-RA | 258 | CG6115-PA | 1..258 | 17..274 | 1290 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:44:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG6115-RB | 743 | CG6115-RB | 133..390 | 17..274 | 1290 | 100 | Plus |
CG6115-RA | 727 | CG6115-RA | 133..390 | 17..274 | 1290 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:44:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 16887462..16887681 | 274..55 | 1085 | 99.5 | Minus |
2L | 23513712 | 2L | 16887793..16887834 | 58..17 | 210 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 11:44:29 has no hits.
BS31166.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-07-13 13:56:28 Download gff for
BS31166.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6115-RA | 129..384 | 17..272 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:31:15 Download gff for
BS31166.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6115-RA | 133..388 | 17..272 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:50:24 Download gff for
BS31166.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6115-RA | 133..388 | 17..272 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:50:24 Download gff for
BS31166.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 16887464..16887677 | 59..272 | 100 | <- | Minus |
2L | 16887793..16887834 | 17..58 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:31:15 Download gff for
BS31166.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 16887464..16887677 | 59..272 | 100 | <- | Minus |
arm_2L | 16887793..16887834 | 17..58 | 100 | | Minus |
BS31166.pep Sequence
Translation from 16 to 273
> BS31166.pep
MSQLRSKVISLYKHLQYLGREYPGLNGPQKFRKQIHDAFMNHKDEQDPKK
IVALLAQGRYLAKEVEALYSLKKYRSVKQRYSYND*
BS31166.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:09:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG6115-PB | 85 | CG6115-PB | 1..85 | 1..85 | 441 | 100 | Plus |
CG6115-PA | 85 | CG6115-PA | 1..85 | 1..85 | 441 | 100 | Plus |