Clone BS31171 Report

Search the DGRC for BS31171

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:311
Well:71
Vector:pDNR-Dual
Associated Gene/TranscriptCG15461-RA
Protein status:BS31171.pep: full length peptide match
Sequenced Size:209

Clone Sequence Records

BS31171.complete Sequence

209 bp assembled on 2012-07-13

GenBank Submission: KX804665

> BS31171.complete
GAAGTTATCAGTCGACATGGTGGAGAAAACCAAAACACTTCAGCTGCTGC
TAATGGCTCGCGCCGTATTGACGATCATCTATAATGACCACTTCTGCTGG
ACCTTCATAAAGAGCTATGGACTCTTCTCGCTGGCGATTCCGCTGGCCAA
GTACTTCGATGGCTTCCAAGTGTTGCCCACCGGTGACGTGTAAAAGCTTT
CTAGACCAT

BS31171.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:44:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG15461-RA 177 CG15461-PA 1..177 17..193 885 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:44:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG15461-RA 332 CG15461-RA 106..282 17..193 885 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:44:18
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20486362..20486538 17..193 885 100 Plus
Blast to na_te.dros performed on 2014-11-28 11:44:19 has no hits.

BS31171.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-07-13 13:56:26 Download gff for BS31171.complete
Subject Subject Range Query Range Percent Splice Strand
CG15461-RA 106..280 17..191 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:31:11 Download gff for BS31171.complete
Subject Subject Range Query Range Percent Splice Strand
CG15461-RA 106..280 17..191 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:50:20 Download gff for BS31171.complete
Subject Subject Range Query Range Percent Splice Strand
CG15461-RA 106..280 17..191 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:50:20 Download gff for BS31171.complete
Subject Subject Range Query Range Percent Splice Strand
X 20486362..20486536 17..191 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:31:11 Download gff for BS31171.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20357389..20357563 17..191 100   Plus

BS31171.pep Sequence

Translation from 16 to 192

> BS31171.pep
MVEKTKTLQLLLMARAVLTIIYNDHFCWTFIKSYGLFSLAIPLAKYFDGF
QVLPTGDV*

BS31171.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:09:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG15461-PA 58 CG15461-PA 1..58 1..58 302 100 Plus