Clone BS31352 Report

Search the DGRC for BS31352

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:313
Well:52
Vector:pDNR-Dual
Associated Gene/TranscriptCG15715-RA
Protein status:BS31352.pep: full length peptide match
Sequenced Size:266

Clone Sequence Records

BS31352.complete Sequence

266 bp assembled on 2012-07-13

GenBank Submission: KX801077

> BS31352.complete
GAAGTTATCAGTCGACATGGCACGTGGACACCAGAAGATCCAGTCGCAGG
CGAAGGCCTCCGAGAAGCAGGCCAAACTAAAGAAGCAACAAGGACACAGT
GCCAACGACCAGAAGAAGGCGGCCCAAAAGGCACTTGTCTATGTGTGCGC
CGTTTGCAAGTCGCAAATGCCCGATCCCAAGACGTATAAACAGCACTTCG
AGAACAAGCATCCCAAGAACGACATACCCGAGGAGCTGAAGGAGGTCTGA
AAGCTTTCTAGACCAT

BS31352.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:45:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG15715-RB 234 CG15715-PB 1..234 17..250 1170 100 Plus
CG15715-RA 234 CG15715-PA 1..234 17..250 1170 100 Plus
CG18081-RC 234 CG18081-PC 1..234 17..250 1035 96.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:45:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG15715-RB 969 CG15715-RB 270..503 17..250 1170 100 Plus
CG15715-RA 735 CG15715-RA 233..466 17..250 1170 100 Plus
CG18081-RC 717 CG18081-RC 198..431 17..250 1035 96.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:45:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15836780..15836923 160..17 720 100 Minus
3L 28110227 3L 15834734..15834877 160..17 705 99.3 Minus
3L 28110227 3L 15836159..15836250 250..159 460 100 Minus
3L 28110227 3L 15834362..15834453 250..159 340 91.3 Minus
Blast to na_te.dros performed on 2014-11-28 11:45:06 has no hits.

BS31352.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-07-13 13:56:34 Download gff for BS31352.complete
Subject Subject Range Query Range Percent Splice Strand
CG15715-RA 231..463 17..249 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:31:29 Download gff for BS31352.complete
Subject Subject Range Query Range Percent Splice Strand
CG15715-RA 233..465 17..249 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:50:34 Download gff for BS31352.complete
Subject Subject Range Query Range Percent Splice Strand
CG15715-RA 233..465 17..249 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:50:34 Download gff for BS31352.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15836160..15836248 161..249 100 <- Minus
3L 15836780..15836923 17..160 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:31:29 Download gff for BS31352.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15829880..15830023 17..160 100   Minus
arm_3L 15829260..15829348 161..249 100 <- Minus

BS31352.pep Sequence

Translation from 16 to 249

> BS31352.pep
MARGHQKIQSQAKASEKQAKLKKQQGHSANDQKKAAQKALVYVCAVCKSQ
MPDPKTYKQHFENKHPKNDIPEELKEV*

BS31352.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:09:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG15715-PB 77 CG15715-PB 1..77 1..77 404 100 Plus
CG15715-PA 77 CG15715-PA 1..77 1..77 404 100 Plus
CG18081-PC 77 CG18081-PC 1..77 1..77 398 97.4 Plus
CG18081-PB 77 CG18081-PB 1..77 1..77 398 97.4 Plus
CG18081-PA 77 CG18081-PA 1..77 1..77 398 97.4 Plus