BS31352.complete Sequence
266 bp assembled on 2012-07-13
GenBank Submission: KX801077
> BS31352.complete
GAAGTTATCAGTCGACATGGCACGTGGACACCAGAAGATCCAGTCGCAGG
CGAAGGCCTCCGAGAAGCAGGCCAAACTAAAGAAGCAACAAGGACACAGT
GCCAACGACCAGAAGAAGGCGGCCCAAAAGGCACTTGTCTATGTGTGCGC
CGTTTGCAAGTCGCAAATGCCCGATCCCAAGACGTATAAACAGCACTTCG
AGAACAAGCATCCCAAGAACGACATACCCGAGGAGCTGAAGGAGGTCTGA
AAGCTTTCTAGACCAT
BS31352.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:45:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15715-RB | 234 | CG15715-PB | 1..234 | 17..250 | 1170 | 100 | Plus |
CG15715-RA | 234 | CG15715-PA | 1..234 | 17..250 | 1170 | 100 | Plus |
CG18081-RC | 234 | CG18081-PC | 1..234 | 17..250 | 1035 | 96.2 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:45:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15715-RB | 969 | CG15715-RB | 270..503 | 17..250 | 1170 | 100 | Plus |
CG15715-RA | 735 | CG15715-RA | 233..466 | 17..250 | 1170 | 100 | Plus |
CG18081-RC | 717 | CG18081-RC | 198..431 | 17..250 | 1035 | 96.2 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:45:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 15836780..15836923 | 160..17 | 720 | 100 | Minus |
3L | 28110227 | 3L | 15834734..15834877 | 160..17 | 705 | 99.3 | Minus |
3L | 28110227 | 3L | 15836159..15836250 | 250..159 | 460 | 100 | Minus |
3L | 28110227 | 3L | 15834362..15834453 | 250..159 | 340 | 91.3 | Minus |
Blast to na_te.dros performed on 2014-11-28 11:45:06 has no hits.
BS31352.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-07-13 13:56:34 Download gff for
BS31352.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15715-RA | 231..463 | 17..249 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:31:29 Download gff for
BS31352.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15715-RA | 233..465 | 17..249 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:50:34 Download gff for
BS31352.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15715-RA | 233..465 | 17..249 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:50:34 Download gff for
BS31352.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15836160..15836248 | 161..249 | 100 | <- | Minus |
3L | 15836780..15836923 | 17..160 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:31:29 Download gff for
BS31352.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 15829880..15830023 | 17..160 | 100 | | Minus |
arm_3L | 15829260..15829348 | 161..249 | 100 | <- | Minus |
BS31352.pep Sequence
Translation from 16 to 249
> BS31352.pep
MARGHQKIQSQAKASEKQAKLKKQQGHSANDQKKAAQKALVYVCAVCKSQ
MPDPKTYKQHFENKHPKNDIPEELKEV*
BS31352.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:09:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15715-PB | 77 | CG15715-PB | 1..77 | 1..77 | 404 | 100 | Plus |
CG15715-PA | 77 | CG15715-PA | 1..77 | 1..77 | 404 | 100 | Plus |
CG18081-PC | 77 | CG18081-PC | 1..77 | 1..77 | 398 | 97.4 | Plus |
CG18081-PB | 77 | CG18081-PB | 1..77 | 1..77 | 398 | 97.4 | Plus |
CG18081-PA | 77 | CG18081-PA | 1..77 | 1..77 | 398 | 97.4 | Plus |