BS31411.complete Sequence
248 bp assembled on 2012-07-13
GenBank Submission: KX800989
> BS31411.complete
GAAGTTATCAGTCGACATGGAATACAGTATTTTCATTTTTCTGGCCCTGA
CTTGTGTCCTATTTATGGGTCAGAGCTGCTTGGCGGCTCCCTCGGCCGAT
GATTTGGCCAAATTTGGTGAAATGGAACGTTCCATCAAGGAGCTGACCAG
TTCGATCCTGGCCATGAGTGGAGCTACTACCGGCTTTAGACCCGGGGCTA
ATAATGTTTGGCCTGAAGATCTTCATGCTTAAAAGCTTTCTAGACCAT
BS31411.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:45:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34337-RA | 216 | CG34337-PA | 1..216 | 17..232 | 1080 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:45:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34337-RA | 371 | CG34337-RA | 20..235 | 17..232 | 1080 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:45:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 7417272..7417438 | 17..183 | 835 | 100 | Plus |
X | 23542271 | X | 7417507..7417557 | 182..232 | 255 | 100 | Plus |
Blast to na_te.dros performed 2014-11-28 11:45:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
412 | 7567 | 412 412 7567bp | 2228..2280 | 248..197 | 100 | 67.9 | Minus |
BS31411.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-07-13 13:56:35 Download gff for
BS31411.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34337-RA | 20..233 | 17..230 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:31:34 Download gff for
BS31411.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34337-RA | 20..233 | 17..230 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:50:36 Download gff for
BS31411.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34337-RA | 20..233 | 17..230 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:50:36 Download gff for
BS31411.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 7417272..7417437 | 17..182 | 100 | -> | Plus |
X | 7417508..7417555 | 183..230 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:31:34 Download gff for
BS31411.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 7311305..7311470 | 17..182 | 100 | -> | Plus |
arm_X | 7311541..7311588 | 183..230 | 100 | | Plus |
BS31411.pep Sequence
Translation from 16 to 231
> BS31411.pep
MEYSIFIFLALTCVLFMGQSCLAAPSADDLAKFGEMERSIKELTSSILAM
SGATTGFRPGANNVWPEDLHA*
BS31411.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:09:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34337-PA | 71 | CG34337-PA | 1..71 | 1..71 | 365 | 100 | Plus |