Clone BS31411 Report

Search the DGRC for BS31411

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:314
Well:11
Vector:pDNR-Dual
Associated Gene/TranscriptCG34337-RA
Protein status:BS31411.pep: full length peptide match
Sequenced Size:248

Clone Sequence Records

BS31411.complete Sequence

248 bp assembled on 2012-07-13

GenBank Submission: KX800989

> BS31411.complete
GAAGTTATCAGTCGACATGGAATACAGTATTTTCATTTTTCTGGCCCTGA
CTTGTGTCCTATTTATGGGTCAGAGCTGCTTGGCGGCTCCCTCGGCCGAT
GATTTGGCCAAATTTGGTGAAATGGAACGTTCCATCAAGGAGCTGACCAG
TTCGATCCTGGCCATGAGTGGAGCTACTACCGGCTTTAGACCCGGGGCTA
ATAATGTTTGGCCTGAAGATCTTCATGCTTAAAAGCTTTCTAGACCAT

BS31411.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:45:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG34337-RA 216 CG34337-PA 1..216 17..232 1080 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:45:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG34337-RA 371 CG34337-RA 20..235 17..232 1080 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:45:14
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7417272..7417438 17..183 835 100 Plus
X 23542271 X 7417507..7417557 182..232 255 100 Plus
Blast to na_te.dros performed 2014-11-28 11:45:16
Subject Length Description Subject Range Query Range Score Percent Strand
412 7567 412 412 7567bp 2228..2280 248..197 100 67.9 Minus

BS31411.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-07-13 13:56:35 Download gff for BS31411.complete
Subject Subject Range Query Range Percent Splice Strand
CG34337-RA 20..233 17..230 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:31:34 Download gff for BS31411.complete
Subject Subject Range Query Range Percent Splice Strand
CG34337-RA 20..233 17..230 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:50:36 Download gff for BS31411.complete
Subject Subject Range Query Range Percent Splice Strand
CG34337-RA 20..233 17..230 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:50:36 Download gff for BS31411.complete
Subject Subject Range Query Range Percent Splice Strand
X 7417272..7417437 17..182 100 -> Plus
X 7417508..7417555 183..230 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:31:34 Download gff for BS31411.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7311305..7311470 17..182 100 -> Plus
arm_X 7311541..7311588 183..230 100   Plus

BS31411.pep Sequence

Translation from 16 to 231

> BS31411.pep
MEYSIFIFLALTCVLFMGQSCLAAPSADDLAKFGEMERSIKELTSSILAM
SGATTGFRPGANNVWPEDLHA*

BS31411.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:09:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG34337-PA 71 CG34337-PA 1..71 1..71 365 100 Plus