Clone BS31667 Report

Search the DGRC for BS31667

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:316
Well:67
Vector:pDNR-Dual
Associated Gene/TranscriptCG34134-RA
Protein status:BS31667.pep: gold
Sequenced Size:392

Clone Sequence Records

BS31667.complete Sequence

392 bp assembled on 2012-08-22

GenBank Submission: KX800571

> BS31667.complete
GAAGTTATCAGTCGACATGCGCGCTCCAGAGTGGATGAGCAATGAAATGG
CGCGCCTCACATCAAGGCTCGAGCGCTACAAGCCAACGGGCAGTGGATAT
AATCGCATCCAGTCGATTCGACTGTCCAAAAGCGTTACCCAAATGCTGAA
CAATCCAATGCCTCCGGCACCAGCCGCTGCCACCGCCAGATCGCAGCCAG
AAAGCTCCTTCACAACGCCGCGACGGCGCGGTGTCCTTAGTCGCACTCAA
TCGGAATGGGAGGAGGTGTATCCTGTCGTCAAGTTCAATCGTCAAGGGAG
CAGCGAGAGCGACATAAGTGAGGATAACGAACTGAGGTTCACCCACTATA
GAAACTGTGCCACGCGTATTCCTTGAAAGCTTTCTAGACCAT

BS31667.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 12:35:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG34134-RA 360 CG34134-PA 1..360 17..376 1800 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:35:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG34134-RA 485 CG34134-RA 41..401 16..376 1805 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 12:35:50
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8190381..8190741 376..16 1805 100 Minus
Blast to na_te.dros performed on 2014-11-28 12:35:51 has no hits.

BS31667.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-08-22 17:26:57 Download gff for BS31667.complete
Subject Subject Range Query Range Percent Splice Strand
CG34134-RA 42..400 17..375 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:45:25 Download gff for BS31667.complete
Subject Subject Range Query Range Percent Splice Strand
CG34134-RA 42..400 17..375 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:07:33 Download gff for BS31667.complete
Subject Subject Range Query Range Percent Splice Strand
CG34134-RA 42..400 17..375 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 13:07:33 Download gff for BS31667.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8190382..8190740 17..375 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:45:25 Download gff for BS31667.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8190382..8190740 17..375 100   Minus

BS31667.pep Sequence

Translation from 16 to 375

> BS31667.pep
MRAPEWMSNEMARLTSRLERYKPTGSGYNRIQSIRLSKSVTQMLNNPMPP
APAAATARSQPESSFTTPRRRGVLSRTQSEWEEVYPVVKFNRQGSSESDI
SEDNELRFTHYRNCATRIP*

BS31667.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:25:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG34134-PA 119 CG34134-PA 1..119 1..119 620 100 Plus