Clone BS32102 Report

Search the DGRC for BS32102

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:321
Well:2
Vector:pDNR-Dual
Associated Gene/TranscriptLysB-RA
Protein status:BS32102.pep: full length peptide match
Sequenced Size:455

Clone Sequence Records

BS32102.complete Sequence

455 bp assembled on 2013-04-19

GenBank Submission: KX801535

> BS32102.complete
GAAGTTATCAGTCGACATGAAGGCTTTCATCGTTCTGGTTGCCCTGGCTC
TGGCCGCTCCTGCTCTTGGTCGCACCATGGACCGTTGCTCCCTGGCCCGG
GAGATGTCCAACCTGGGCGTTCCTCGTGACCAATTGGCTCGTTGGGCCTG
CATTGCCGAGCACGAGTCCTCCTACCGCACCGGAGTGGTTGGTCCCGAGA
ACTACAACGGCTCCAACGACTACGGAATCTTCCAGATCAACGACTACTAC
TGGTGCGCTCCTCCCAGCGGTCGCTTCTCCTACAATGAGTGCGGGTTGAG
CTGCAATGCCCTCTTGACCGACGACATCACCCACTCCGTCCGTTGTGCCC
AGAAGGTCCTCAGCCAGCAGGGATGGTCCGCCTGGTCCACCTGGCACTAC
TGCAGCGGATGGTTGCCGTCCATCGATGACTGCTTCTAAAAGCTTTCTAG
ACCAT

BS32102.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:18:18
Subject Length Description Subject Range Query Range Score Percent Strand
LysB-RB 423 CG1179-PB 1..423 17..439 2115 100 Plus
LysB-RA 423 CG1179-PA 1..423 17..439 2115 100 Plus
LysE-RA 423 CG1180-PA 1..423 17..439 1890 96.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:18:19
Subject Length Description Subject Range Query Range Score Percent Strand
LysB-RB 611 CG1179-RB 22..447 15..440 2130 100 Plus
LysB-RA 486 CG1179-RA 22..447 15..440 2130 100 Plus
LysE-RA 580 CG1180-RA 126..549 17..440 1895 96.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:18:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1207392..1207817 15..440 2130 100 Plus
3L 28110227 3L 1212952..1213375 17..440 1895 96.5 Plus
3L 28110227 3L 1210754..1211178 440..16 1885 96.2 Minus
3L 28110227 3L 1227770..1228195 15..440 995 83.2 Plus
3L 28110227 3L 1210484..1210726 16..258 900 91.4 Plus
3L 28110227 3L 1218286..1218607 410..89 680 80.7 Minus
3L 28110227 3L 1194874..1195241 435..68 625 78 Minus
Blast to na_te.dros performed on 2014-11-28 13:18:17 has no hits.

BS32102.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-04-19 17:05:33 Download gff for BS32102.complete
Subject Subject Range Query Range Percent Splice Strand
LysB-RA 24..444 17..437 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:02:59 Download gff for BS32102.complete
Subject Subject Range Query Range Percent Splice Strand
LysB-RA 24..444 17..437 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:25:44 Download gff for BS32102.complete
Subject Subject Range Query Range Percent Splice Strand
LysB-RA 24..444 17..437 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:25:44 Download gff for BS32102.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1207394..1207814 17..437 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:02:59 Download gff for BS32102.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1207394..1207814 17..437 100   Plus

BS32102.pep Sequence

Translation from 16 to 438

> BS32102.pep
MKAFIVLVALALAAPALGRTMDRCSLAREMSNLGVPRDQLARWACIAEHE
SSYRTGVVGPENYNGSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNALL
TDDITHSVRCAQKVLSQQGWSAWSTWHYCSGWLPSIDDCF*

BS32102.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:11:07
Subject Length Description Subject Range Query Range Score Percent Strand
LysB-PB 140 CG1179-PB 1..140 1..140 779 100 Plus
LysB-PA 140 CG1179-PA 1..140 1..140 779 100 Plus
LysD-PA 140 CG9118-PA 1..140 1..140 770 98.6 Plus
LysE-PA 140 CG1180-PA 1..140 1..140 762 97.1 Plus
LysC-PA 140 CG9111-PA 1..140 1..140 761 97.1 Plus