BS32102.complete Sequence
455 bp assembled on 2013-04-19
GenBank Submission: KX801535
> BS32102.complete
GAAGTTATCAGTCGACATGAAGGCTTTCATCGTTCTGGTTGCCCTGGCTC
TGGCCGCTCCTGCTCTTGGTCGCACCATGGACCGTTGCTCCCTGGCCCGG
GAGATGTCCAACCTGGGCGTTCCTCGTGACCAATTGGCTCGTTGGGCCTG
CATTGCCGAGCACGAGTCCTCCTACCGCACCGGAGTGGTTGGTCCCGAGA
ACTACAACGGCTCCAACGACTACGGAATCTTCCAGATCAACGACTACTAC
TGGTGCGCTCCTCCCAGCGGTCGCTTCTCCTACAATGAGTGCGGGTTGAG
CTGCAATGCCCTCTTGACCGACGACATCACCCACTCCGTCCGTTGTGCCC
AGAAGGTCCTCAGCCAGCAGGGATGGTCCGCCTGGTCCACCTGGCACTAC
TGCAGCGGATGGTTGCCGTCCATCGATGACTGCTTCTAAAAGCTTTCTAG
ACCAT
BS32102.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:18:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
LysB-RB | 423 | CG1179-PB | 1..423 | 17..439 | 2115 | 100 | Plus |
LysB-RA | 423 | CG1179-PA | 1..423 | 17..439 | 2115 | 100 | Plus |
LysE-RA | 423 | CG1180-PA | 1..423 | 17..439 | 1890 | 96.5 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:18:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
LysB-RB | 611 | CG1179-RB | 22..447 | 15..440 | 2130 | 100 | Plus |
LysB-RA | 486 | CG1179-RA | 22..447 | 15..440 | 2130 | 100 | Plus |
LysE-RA | 580 | CG1180-RA | 126..549 | 17..440 | 1895 | 96.5 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:18:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 1207392..1207817 | 15..440 | 2130 | 100 | Plus |
3L | 28110227 | 3L | 1212952..1213375 | 17..440 | 1895 | 96.5 | Plus |
3L | 28110227 | 3L | 1210754..1211178 | 440..16 | 1885 | 96.2 | Minus |
3L | 28110227 | 3L | 1227770..1228195 | 15..440 | 995 | 83.2 | Plus |
3L | 28110227 | 3L | 1210484..1210726 | 16..258 | 900 | 91.4 | Plus |
3L | 28110227 | 3L | 1218286..1218607 | 410..89 | 680 | 80.7 | Minus |
3L | 28110227 | 3L | 1194874..1195241 | 435..68 | 625 | 78 | Minus |
Blast to na_te.dros performed on 2014-11-28 13:18:17 has no hits.
BS32102.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-04-19 17:05:33 Download gff for
BS32102.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
LysB-RA | 24..444 | 17..437 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:02:59 Download gff for
BS32102.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
LysB-RA | 24..444 | 17..437 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:25:44 Download gff for
BS32102.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
LysB-RA | 24..444 | 17..437 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:25:44 Download gff for
BS32102.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 1207394..1207814 | 17..437 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:02:59 Download gff for
BS32102.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 1207394..1207814 | 17..437 | 100 | | Plus |
BS32102.pep Sequence
Translation from 16 to 438
> BS32102.pep
MKAFIVLVALALAAPALGRTMDRCSLAREMSNLGVPRDQLARWACIAEHE
SSYRTGVVGPENYNGSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNALL
TDDITHSVRCAQKVLSQQGWSAWSTWHYCSGWLPSIDDCF*
BS32102.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:11:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
LysB-PB | 140 | CG1179-PB | 1..140 | 1..140 | 779 | 100 | Plus |
LysB-PA | 140 | CG1179-PA | 1..140 | 1..140 | 779 | 100 | Plus |
LysD-PA | 140 | CG9118-PA | 1..140 | 1..140 | 770 | 98.6 | Plus |
LysE-PA | 140 | CG1180-PA | 1..140 | 1..140 | 762 | 97.1 | Plus |
LysC-PA | 140 | CG9111-PA | 1..140 | 1..140 | 761 | 97.1 | Plus |