Clone BS32122 Report

Search the DGRC for BS32122

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:321
Well:22
Vector:pDNR-Dual
Associated Gene/TranscriptCG13202-RA
Protein status:BS32122.pep: gold
Sequenced Size:278

Clone Sequence Records

BS32122.complete Sequence

278 bp assembled on 2013-04-19

GenBank Submission: KX803672

> BS32122.complete
GAAGTTATCAGTCGACATGGATAACTGGAAGATAACCGCGGAGGAGCTTA
TCCGTCTGCGGGAGAGCTGCTTGCAGTGCATCCGTGATGGAGAACTCTAT
GAACTGCGCAACGATGCCAAACTTAGGGCTGTTTATAGCACTCAGAACTA
CGAAGAATTCAAGAACATAGTGGATGCGGCTCATCTTCGTCCAGTGACCA
AGGGCGACAAGGCGAATTTTAAGACGAAGAATCGACTATGGAACTCGGCG
GCCCGGGATTAAAAGCTTTCTAGACCAT

BS32122.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:18:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG13202-RA 246 CG13202-PA 1..246 17..262 1230 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:18:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG13202-RA 426 CG13202-RA 125..374 13..262 1250 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:18:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11356326..11356476 163..13 755 100 Minus
2R 25286936 2R 11356166..11356269 262..159 505 99 Minus
Blast to na_te.dros performed on 2014-11-28 13:18:41 has no hits.

BS32122.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-04-19 17:09:32 Download gff for BS32122.complete
Subject Subject Range Query Range Percent Splice Strand
CG13202-RA 22..265 17..260 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:03:13 Download gff for BS32122.complete
Subject Subject Range Query Range Percent Splice Strand
CG13202-RA 129..372 17..260 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:25:53 Download gff for BS32122.complete
Subject Subject Range Query Range Percent Splice Strand
CG13202-RA 129..372 17..260 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:25:53 Download gff for BS32122.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11356168..11356265 163..260 100 <- Minus
2R 11356327..11356472 17..162 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:03:13 Download gff for BS32122.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7243673..7243770 163..260 100 <- Minus
arm_2R 7243832..7243977 17..162 100   Minus

BS32122.pep Sequence

Translation from 16 to 261

> BS32122.pep
MDNWKITAEELIRLRESCLQCIRDGELYELRNDAKLRAVYSTQNYEEFKN
IVDAAHLRPVTKGDKANFKTKNRLWNSAARD*

BS32122.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:13:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG13202-PA 81 CG13202-PA 1..81 1..81 427 100 Plus