Clone BS32131 Report

Search the DGRC for BS32131

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:321
Well:31
Vector:pDNR-Dual
Associated Gene/TranscriptCG13230-RA
Protein status:BS32131.pep: full length peptide match
Sequenced Size:251

Clone Sequence Records

BS32131.complete Sequence

251 bp assembled on 2013-04-19

GenBank Submission: KX804902

> BS32131.complete
GAAGTTATCAGTCGACATGTCGAGAATCCTTGTCGCCGCCATCGCCTTCG
TTACCATCTGTCTGGTCCTTGTCAGCGCCGCCCCCGCTCCCGCCCCGCCC
ACACAGATCCTGGATGCCCGGACGGCCATCCAGAAGATAATCGACGCTTA
CAATCGGATTCCGGGTCCTTCAGTTGTTCACCCCTGGGAGGTGGCCACTT
TGATTGACCCGAACACCTTTGTGGCCCAATTCTGAAAGCTTTCTAGACCA
T

BS32131.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:23:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG13230-RA 219 CG13230-PA 1..219 17..235 1095 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:23:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG13230-RA 318 CG13230-RA 33..252 17..236 1100 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:23:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11154928..11155054 17..143 635 100 Plus
2R 25286936 2R 11155134..11155227 143..236 470 100 Plus
Blast to na_te.dros performed on 2014-11-28 13:23:24 has no hits.

BS32131.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-04-19 18:06:18 Download gff for BS32131.complete
Subject Subject Range Query Range Percent Splice Strand
CG13230-RA 1..218 17..234 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:05:31 Download gff for BS32131.complete
Subject Subject Range Query Range Percent Splice Strand
CG13230-RA 33..250 17..234 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:27:36 Download gff for BS32131.complete
Subject Subject Range Query Range Percent Splice Strand
CG13230-RA 33..250 17..234 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:27:36 Download gff for BS32131.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11154928..11155054 17..143 100 -> Plus
2R 11155135..11155225 144..234 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:05:31 Download gff for BS32131.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7042433..7042559 17..143 100 -> Plus
arm_2R 7042640..7042730 144..234 100   Plus

BS32131.pep Sequence

Translation from 16 to 234

> BS32131.pep
MSRILVAAIAFVTICLVLVSAAPAPAPPTQILDARTAIQKIIDAYNRIPG
PSVVHPWEVATLIDPNTFVAQF*

BS32131.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:11:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG13230-PA 72 CG13230-PA 1..72 1..72 363 100 Plus