BS32131.complete Sequence
251 bp assembled on 2013-04-19
GenBank Submission: KX804902
> BS32131.complete
GAAGTTATCAGTCGACATGTCGAGAATCCTTGTCGCCGCCATCGCCTTCG
TTACCATCTGTCTGGTCCTTGTCAGCGCCGCCCCCGCTCCCGCCCCGCCC
ACACAGATCCTGGATGCCCGGACGGCCATCCAGAAGATAATCGACGCTTA
CAATCGGATTCCGGGTCCTTCAGTTGTTCACCCCTGGGAGGTGGCCACTT
TGATTGACCCGAACACCTTTGTGGCCCAATTCTGAAAGCTTTCTAGACCA
T
BS32131.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:23:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13230-RA | 219 | CG13230-PA | 1..219 | 17..235 | 1095 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:23:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13230-RA | 318 | CG13230-RA | 33..252 | 17..236 | 1100 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:23:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 11154928..11155054 | 17..143 | 635 | 100 | Plus |
2R | 25286936 | 2R | 11155134..11155227 | 143..236 | 470 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 13:23:24 has no hits.
BS32131.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-04-19 18:06:18 Download gff for
BS32131.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13230-RA | 1..218 | 17..234 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:05:31 Download gff for
BS32131.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13230-RA | 33..250 | 17..234 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:27:36 Download gff for
BS32131.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13230-RA | 33..250 | 17..234 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:27:36 Download gff for
BS32131.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11154928..11155054 | 17..143 | 100 | -> | Plus |
2R | 11155135..11155225 | 144..234 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:05:31 Download gff for
BS32131.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 7042433..7042559 | 17..143 | 100 | -> | Plus |
arm_2R | 7042640..7042730 | 144..234 | 100 | | Plus |
BS32131.pep Sequence
Translation from 16 to 234
> BS32131.pep
MSRILVAAIAFVTICLVLVSAAPAPAPPTQILDARTAIQKIIDAYNRIPG
PSVVHPWEVATLIDPNTFVAQF*
BS32131.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:11:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13230-PA | 72 | CG13230-PA | 1..72 | 1..72 | 363 | 100 | Plus |