Clone BS32132 Report

Search the DGRC for BS32132

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:321
Well:32
Vector:pDNR-Dual
Associated Gene/TranscriptCG34223-RA
Protein status:BS32132.pep: full length peptide match
Sequenced Size:317

Clone Sequence Records

BS32132.complete Sequence

317 bp assembled on 2013-04-19

GenBank Submission: KX800162

> BS32132.complete
GAAGTTATCAGTCGACATGTTCCGCTTGCTGCTGCTGTGGATCACTGTGG
GGCTGGTGGCAGCTCTGGATGAGCGGGAATTCGATCCGCAGGTGGCACCA
CCTCAAAGTTCAGTTCCAAAACCCTTTCAGCTGTGGCGAAGTTTTGCGAG
TCATGTGCGTCTTGTCTTTAGTCGTCTTCAACCTAAGTCACCAACTCCGC
CCACCGTTAGGACCAAAACGGGTATAACTACCACCACTCCCGAACCTGAA
CTGCAGTTCTATGGAGCTCTGAATCCCATATACCAAACAGGGAACTTTTA
AAAGCTTTCTAGACCAT

BS32132.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:23:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG34223-RA 285 CG34223-PA 1..285 17..301 1425 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:23:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG34223-RA 285 CG34223-RA 1..285 17..301 1425 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:23:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11236014..11236204 111..301 955 100 Plus
2R 25286936 2R 11235860..11235956 17..113 485 100 Plus
Blast to na_te.dros performed 2014-11-28 13:23:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6983..7022 40..1 101 72.5 Minus

BS32132.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-04-19 18:07:15 Download gff for BS32132.complete
Subject Subject Range Query Range Percent Splice Strand
CG34223-RA 6..283 22..299 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:05:34 Download gff for BS32132.complete
Subject Subject Range Query Range Percent Splice Strand
CG34223-RA 6..283 22..299 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:27:37 Download gff for BS32132.complete
Subject Subject Range Query Range Percent Splice Strand
CG34223-RA 6..283 22..299 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:27:37 Download gff for BS32132.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11236017..11236202 114..299 100   Plus
2R 11235865..11235956 22..113 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:05:34 Download gff for BS32132.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7123522..7123707 114..299 100   Plus
arm_2R 7123370..7123461 22..113 100 -> Plus

BS32132.pep Sequence

Translation from 16 to 300

> BS32132.pep
MFRLLLLWITVGLVAALDEREFDPQVAPPQSSVPKPFQLWRSFASHVRLV
FSRLQPKSPTPPTVRTKTGITTTTPEPELQFYGALNPIYQTGNF*

BS32132.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:11:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG34223-PA 94 CG34223-PA 1..94 1..94 496 100 Plus