Clone BS32144 Report

Search the DGRC for BS32144

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:321
Well:44
Vector:pDNR-Dual
Associated Gene/TranscriptCG6244-RA
Protein status:BS32144.pep: full length peptide match
Sequenced Size:281

Clone Sequence Records

BS32144.complete Sequence

281 bp assembled on 2013-04-19

GenBank Submission: KX800349

> BS32144.complete
GAAGTTATCAGTCGACATGGGTCGTCGCAAGTCCAAACGCAAAGGAGCCC
CAAGAAAGAAAAATATTCAGCCGCTGCCCATTCTTTTCGATTGTCCATTC
TGCAATCACAAGCAGTCATGTGAAGCGAAACTAGATAAGGCGAAAAAAAT
AGGAAGAATTACCTGTACCGTGTGCCAAGAATTTTTTCAAACACATATAA
ACTATCTCACGGAGGCAATTGATGTGTTCAACGATTGGATTGATGCTTGC
GAGGAGGAGAACTAAAAGCTTTCTAGACCAT

BS32144.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:24:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG6244-RA 249 CG6244-PA 1..249 17..265 1245 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:24:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG6244-RA 509 CG6244-RA 96..345 16..265 1250 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:24:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15808587..15808719 133..265 665 100 Plus
3L 28110227 3L 15808417..15808533 16..132 585 100 Plus
Blast to na_te.dros performed on 2014-11-28 13:24:15 has no hits.

BS32144.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-04-19 18:15:23 Download gff for BS32144.complete
Subject Subject Range Query Range Percent Splice Strand
CG6244-RA 1..247 17..263 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:05:57 Download gff for BS32144.complete
Subject Subject Range Query Range Percent Splice Strand
CG6244-RA 97..343 17..263 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:27:54 Download gff for BS32144.complete
Subject Subject Range Query Range Percent Splice Strand
CG6244-RA 97..343 17..263 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:27:54 Download gff for BS32144.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15808418..15808533 17..132 100 -> Plus
3L 15808587..15808717 133..263 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:05:57 Download gff for BS32144.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15801518..15801633 17..132 100 -> Plus
arm_3L 15801687..15801817 133..263 100   Plus

BS32144.pep Sequence

Translation from 16 to 264

> BS32144.pep
MGRRKSKRKGAPRKKNIQPLPILFDCPFCNHKQSCEAKLDKAKKIGRITC
TVCQEFFQTHINYLTEAIDVFNDWIDACEEEN*

BS32144.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:11:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG6244-PA 82 CG6244-PA 1..82 1..82 454 100 Plus
CG40228-PD 82 CG40228-PD 1..82 1..82 306 63.4 Plus
CG40228-PC 82 CG40228-PC 1..82 1..82 306 63.4 Plus
CG40228-PE 77 CG40228-PE 1..77 1..82 269 59.8 Plus
CG40228-PF 43 CG40228-PF 1..34 1..34 133 67.6 Plus