Clone BS32161 Report

Search the DGRC for BS32161

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:321
Well:61
Vector:pDNR-Dual
Associated Gene/TranscriptRdh-RA
Protein status:BS32161.pep: full length peptide match
Sequenced Size:176

Clone Sequence Records

BS32161.complete Sequence

176 bp assembled on 2013-04-19

GenBank Submission: KX802957

> BS32161.complete
GAAGTTATCAGTCGACATGTCCGCCAGCGGTCGTCGCTTCTGTCGCAGCC
GTTGCCAAAGTTGTCATTGTCATCCGTACCAGCAAACGCAGCAGCAAAAG
CAGCAGCAGCAGCAGCAGCAGCAACATCAGGCAGCAGCAGCAGCAGCAAC
TAGCAACTAGAAGCTTTCTAGACCAT

BS32161.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:25:18
Subject Length Description Subject Range Query Range Score Percent Strand
Rdh-RA 144 CG14975-PA 1..144 17..160 720 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:25:20
Subject Length Description Subject Range Query Range Score Percent Strand
Rdh-RA 440 CG14975-RA 76..223 17..164 725 99.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:25:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3825524..3825671 17..164 725 99.3 Plus
Blast to na_te.dros performed on 2014-11-28 13:25:18 has no hits.

BS32161.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-04-19 18:28:22 Download gff for BS32161.complete
Subject Subject Range Query Range Percent Splice Strand
Rdh-RA 1..144 17..160 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:06:25 Download gff for BS32161.complete
Subject Subject Range Query Range Percent Splice Strand
Rdh-RA 76..219 17..160 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:28:14 Download gff for BS32161.complete
Subject Subject Range Query Range Percent Splice Strand
Rdh-RA 76..219 17..160 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:28:14 Download gff for BS32161.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3825524..3825667 17..160 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:06:25 Download gff for BS32161.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3825524..3825667 17..160 100   Plus

BS32161.pep Sequence

Translation from 16 to 159

> BS32161.pep
MSASGRRFCRSRCQSCHCHPYQQTQQQKQQQQQQQQHQAAAAAATSN*

BS32161.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:12:11
Subject Length Description Subject Range Query Range Score Percent Strand
Rdh-PA 47 CG14975-PA 1..47 1..47 255 100 Plus