BS32161.complete Sequence
176 bp assembled on 2013-04-19
GenBank Submission: KX802957
> BS32161.complete
GAAGTTATCAGTCGACATGTCCGCCAGCGGTCGTCGCTTCTGTCGCAGCC
GTTGCCAAAGTTGTCATTGTCATCCGTACCAGCAAACGCAGCAGCAAAAG
CAGCAGCAGCAGCAGCAGCAGCAACATCAGGCAGCAGCAGCAGCAGCAAC
TAGCAACTAGAAGCTTTCTAGACCAT
BS32161.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:25:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Rdh-RA | 144 | CG14975-PA | 1..144 | 17..160 | 720 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:25:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Rdh-RA | 440 | CG14975-RA | 76..223 | 17..164 | 725 | 99.3 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:25:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 3825524..3825671 | 17..164 | 725 | 99.3 | Plus |
Blast to na_te.dros performed on 2014-11-28 13:25:18 has no hits.
BS32161.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-04-19 18:28:22 Download gff for
BS32161.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Rdh-RA | 1..144 | 17..160 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:06:25 Download gff for
BS32161.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Rdh-RA | 76..219 | 17..160 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:28:14 Download gff for
BS32161.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Rdh-RA | 76..219 | 17..160 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:28:14 Download gff for
BS32161.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3825524..3825667 | 17..160 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:06:25 Download gff for
BS32161.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 3825524..3825667 | 17..160 | 100 | | Plus |
BS32161.pep Sequence
Translation from 16 to 159
> BS32161.pep
MSASGRRFCRSRCQSCHCHPYQQTQQQKQQQQQQQQHQAAAAAATSN*
BS32161.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:12:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Rdh-PA | 47 | CG14975-PA | 1..47 | 1..47 | 255 | 100 | Plus |