Clone BS32164 Report

Search the DGRC for BS32164

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:321
Well:64
Vector:pDNR-Dual
Associated Gene/TranscriptCG4982-RA
Protein status:BS32164.pep: gold
Sequenced Size:374

Clone Sequence Records

BS32164.complete Sequence

374 bp assembled on 2013-04-19

GenBank Submission: KX802329

> BS32164.complete
GAAGTTATCAGTCGACATGTTCAAAGTTGTGTTCCTTTTGTGCGGAGTAT
TCGCTGTCCTGATCCAGGCTCGCCCCAGCTACTTGCCCAGCTATGAGCAC
GTGGAATATGCTCCCAGTGTCGTAGGATACGAGAGTTATGCCCTTCCAGC
CGCCGTCTCACACCAGAGTTCCACAGTGGTGCACGAGAAGCGTCCCTACT
GGCGCCCCATTGTGGATCACACGCCCATCCTGAAGGCAGCCTATGCTCCA
GCTACTTCGATCTCGTATGCCCCACTTGGATACGCGGGCAACAGTGCGGG
ATGGTACGAGCCGGGAATCTGGGGAGTATCCAGTTACCCCAGCATTTATC
TGAAGTAGAAGCTTTCTAGACCAT

BS32164.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:25:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG4982-RA 342 CG4982-PA 1..342 17..358 1710 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:25:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG4982-RA 512 CG4982-RA 32..375 17..360 1720 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:25:21
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16301559..16301890 29..360 1660 100 Plus
Blast to na_te.dros performed on 2014-11-28 13:25:22 has no hits.

BS32164.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-04-19 18:28:40 Download gff for BS32164.complete
Subject Subject Range Query Range Percent Splice Strand
CG4982-RA 20..356 22..358 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:06:27 Download gff for BS32164.complete
Subject Subject Range Query Range Percent Splice Strand
CG4982-RA 37..373 22..358 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:28:16 Download gff for BS32164.complete
Subject Subject Range Query Range Percent Splice Strand
CG4982-RA 37..373 22..358 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:28:16 Download gff for BS32164.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16301554..16301888 22..358 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:06:27 Download gff for BS32164.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16294654..16294988 22..358 98   Plus

BS32164.pep Sequence

Translation from 16 to 357

> BS32164.pep
MFKVVFLLCGVFAVLIQARPSYLPSYEHVEYAPSVVGYESYALPAAVSHQ
SSTVVHEKRPYWRPIVDHTPILKAAYAPATSISYAPLGYAGNSAGWYEPG
IWGVSSYPSIYLK*

BS32164.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:12:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG4982-PA 113 CG4982-PA 1..113 1..113 605 100 Plus