Clone BS32193 Report

Search the DGRC for BS32193

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:321
Well:93
Vector:pDNR-Dual
Associated Gene/TranscriptCG11269-RA
Protein status:BS32193.pep: full length peptide match
Sequenced Size:356

Clone Sequence Records

BS32193.complete Sequence

356 bp assembled on 2013-04-19

GenBank Submission: KX803280

> BS32193.complete
GAAGTTATCAGTCGACATGTTTTGTGGTCGCAAGTGCTGTCTGTTCTGCC
TGTTCATGAGCGCCTGGGGCTTCTTGATGCTGAATCTGCTGGGTATCTTC
TTCTACGTCCAGTCACTGATGCTCCTGGAGTCCCTGCCCTTGCCCCACCA
CTTCCCCAGTCAGGAGGCCTTCAAGGAGCAGGCGGACGAGGCCTACCAGG
ACGTGTCCACACGGTGCTTTGTAGCCGCCGTTTTCTATCTGGGATTCGTC
TTCATTGCGATAGTGGCCATTCGTCGGGATAACAAGAGAAGGAAGCGACT
CTACAAGCGGGGTCCCGGTCACTTGCGATTCCGTCGTTGAAAGCTTTCTA
GACCAT

BS32193.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:27:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG11269-RA 324 CG11269-PA 1..324 17..340 1620 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:28:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG11269-RA 401 CG11269-RA 48..371 17..340 1620 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:27:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22138942..22139265 17..340 1620 100 Plus
Blast to na_te.dros performed on 2014-11-28 13:27:53 has no hits.

BS32193.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-04-19 18:38:28 Download gff for BS32193.complete
Subject Subject Range Query Range Percent Splice Strand
CG11269-RA 8..323 24..339 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:07:04 Download gff for BS32193.complete
Subject Subject Range Query Range Percent Splice Strand
CG11269-RA 55..370 24..339 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:28:43 Download gff for BS32193.complete
Subject Subject Range Query Range Percent Splice Strand
CG11269-RA 55..370 24..339 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:28:43 Download gff for BS32193.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22138949..22139264 24..339 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:07:04 Download gff for BS32193.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18026454..18026769 24..339 100   Plus

BS32193.pep Sequence

Translation from 16 to 339

> BS32193.pep
MFCGRKCCLFCLFMSAWGFLMLNLLGIFFYVQSLMLLESLPLPHHFPSQE
AFKEQADEAYQDVSTRCFVAAVFYLGFVFIAIVAIRRDNKRRKRLYKRGP
GHLRFRR*

BS32193.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:12:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG11269-PA 107 CG11269-PA 1..107 1..107 573 100 Plus
CG40127-PA 95 CG40127-PA 4..76 3..75 156 41.1 Plus
CG40127-PB 95 CG40127-PB 4..76 3..75 156 41.1 Plus