Clone BS32194 Report

Search the DGRC for BS32194

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:321
Well:94
Vector:pDNR-Dual
Associated Gene/TranscriptCG34189-RA
Protein status:BS32194.pep: gold
Sequenced Size:404

Clone Sequence Records

BS32194.complete Sequence

404 bp assembled on 2013-04-19

GenBank Submission: KX801694

> BS32194.complete
GAAGTTATCAGTCGACATGATGGTTTGGTTCAATTCCCTCTGCTTTCTGC
TGCTGCCGGCCTTGCTGATGGATTCGGTCATGACAACTGGCATCGACGAG
GATCATATCCTGAACCATGATGTGGACCCGGATCCGGGCCGCATGAAGTA
CATATGGAATCCGTTTTCGGGATTTTGCGGCGAGAATGCCACCATGGTGA
GGTGTGCTGGAGTTTGCCCCGAAACCTGTGCCTTCAAATCGCTCAAGTGT
CCCAAATATTGCGGTGTAAATTGCGTATGCAAACCTGACTATGTCTTTAA
CGAAAATCTGCAACTATGCATCCTTAAAACTGATTGTCCTCTAGACATAA
AGCAACTGGTTGTTGAAACTCATCGCGTTTTTCAGTAAAAGCTTTCTAGA
CCAT

BS32194.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG34189-RA 369 CG34189-PA 1..369 20..388 1845 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:26:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG34189-RA 482 CG34189-RA 60..436 16..392 1885 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:26:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16754503..16754879 16..392 1885 100 Plus
Blast to na_te.dros performed on 2014-11-28 13:26:43 has no hits.

BS32194.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-04-19 18:35:10 Download gff for BS32194.complete
Subject Subject Range Query Range Percent Splice Strand
CG34189-RA 1..367 20..386 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:06:56 Download gff for BS32194.complete
Subject Subject Range Query Range Percent Splice Strand
CG34189-RA 61..430 17..386 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:28:37 Download gff for BS32194.complete
Subject Subject Range Query Range Percent Splice Strand
CG34189-RA 61..430 17..386 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:28:37 Download gff for BS32194.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16754504..16754873 17..386 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:06:56 Download gff for BS32194.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12642009..12642378 17..386 100   Plus

BS32194.pep Sequence

Translation from 16 to 387

> BS32194.pep
MMVWFNSLCFLLLPALLMDSVMTTGIDEDHILNHDVDPDPGRMKYIWNPF
SGFCGENATMVRCAGVCPETCAFKSLKCPKYCGVNCVCKPDYVFNENLQL
CILKTDCPLDIKQLVVETHRVFQ*

BS32194.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:12:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG34189-PA 122 CG34189-PA 1..122 2..123 689 100 Plus
CG5267-PA 178 CG5267-PA 99..177 44..122 193 48.1 Plus
Acp62F-PA 115 CG1262-PA 34..92 54..111 170 47.5 Plus
CG33259-PA 119 CG33259-PA 27..87 54..113 148 44.3 Plus