Clone BS32195 Report

Search the DGRC for BS32195

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:321
Well:95
Vector:pDNR-Dual
Associated Gene/TranscriptCG42765-RA
Protein status:BS32195.pep: full length peptide match
Sequenced Size:224

Clone Sequence Records

BS32195.complete Sequence

224 bp assembled on 2013-04-19

GenBank Submission: KX802425

> BS32195.complete
GAAGTTATCAGTCGACATGCGGTGCCGGCTAATACGAAATGCAAATGATT
GCAAAGTGTATGCAATTTGGACACTACCCATTAAATTAAATATAAACACT
TTGATATATCCATGGAAATCTAGAAGCTTCAAGCATGCGAATGTGATTTC
TATTTATGAGCACACAAGTTGTGTGTCTGGGTTCATAAATTTTCCAGCTT
CCAATTGAAAGCTTTCTAGACCAT

BS32195.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-28 13:22:19 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-28 13:22:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:22:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26325034..26325227 209..16 970 100 Minus
Blast to na_te.dros performed on 2014-11-28 13:22:18 has no hits.

BS32195.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-04-19 17:54:37 Download gff for BS32195.complete
Subject Subject Range Query Range Percent Splice Strand
CG42765-RA 50..240 17..207 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:04:59 Download gff for BS32195.complete
Subject Subject Range Query Range Percent Splice Strand
CG42765-RA 50..240 17..207 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:27:09 Download gff for BS32195.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26325036..26325226 17..207 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:27:09 Download gff for BS32195.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26325036..26325226 17..207 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:04:59 Download gff for BS32195.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22150758..22150948 17..207 100   Minus

BS32195.pep Sequence

Translation from 16 to 207

> BS32195.pep
MRCRLIRNANDCKVYAIWTLPIKLNINTLIYPWKSRSFKHANVISIYEHT
SCVSGFINFPASN*
Sequence BS32195.pep has no blast hits.