BS32262.complete Sequence
188 bp assembled on 2013-04-19
GenBank Submission: KX804898
> BS32262.complete
GAAGTTATCAGTCGACATGGGAGTTGCTACCAAAATCTTTCGTTCGCACG
TTCAAGGCAGCAAAAAAGCAAAAGCAACAGCCACATCAAGAAGCGCAACA
AGAAGGCCAAGAACAGTACGGTACAGTAAGGACTGCCTGTGCGGAATGTT
GTGTAAAAATAAATACGCCTAAAAGCTTTCTAGACCAT
BS32262.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-28 13:17:56 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-28 13:17:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:17:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 2322125..2322265 | 156..16 | 705 | 100 | Minus |
Blast to na_te.dros performed 2014-11-28 13:17:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X-element | 4740 | X-element ROXELEMENT 4740bp | 1540..1582 | 58..98 | 110 | 79.1 | Plus |
BS32262.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-04-19 17:01:03 Download gff for
BS32262.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34052-RA | 1..154 | 17..170 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:25:35 Download gff for
BS32262.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 2322125..2322264 | 17..156 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:25:35 Download gff for
BS32262.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 2322125..2322264 | 17..156 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:02:50 Download gff for
BS32262.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 2216158..2216297 | 17..156 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:02:50 Download gff for
BS32262.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 2216158..2216297 | 17..156 | 100 | | Minus |
BS32262.pep Sequence
Translation from 16 to 171
> BS32262.pep
MGVATKIFRSHVQGSKKAKATATSRSATRRPRTVRYSKDCLCGMLCKNKY
A*
Sequence BS32262.pep has no blast hits.