Clone BS32262 Report

Search the DGRC for BS32262

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:322
Well:62
Vector:pDNR-Dual
Associated Gene/TranscriptCG34052-RA
Protein status:BS32262.pep: full length peptide match
Sequenced Size:188

Clone Sequence Records

BS32262.complete Sequence

188 bp assembled on 2013-04-19

GenBank Submission: KX804898

> BS32262.complete
GAAGTTATCAGTCGACATGGGAGTTGCTACCAAAATCTTTCGTTCGCACG
TTCAAGGCAGCAAAAAAGCAAAAGCAACAGCCACATCAAGAAGCGCAACA
AGAAGGCCAAGAACAGTACGGTACAGTAAGGACTGCCTGTGCGGAATGTT
GTGTAAAAATAAATACGCCTAAAAGCTTTCTAGACCAT

BS32262.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-28 13:17:56 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-28 13:17:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:17:54
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2322125..2322265 156..16 705 100 Minus
Blast to na_te.dros performed 2014-11-28 13:17:55
Subject Length Description Subject Range Query Range Score Percent Strand
X-element 4740 X-element ROXELEMENT 4740bp 1540..1582 58..98 110 79.1 Plus

BS32262.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-04-19 17:01:03 Download gff for BS32262.complete
Subject Subject Range Query Range Percent Splice Strand
CG34052-RA 1..154 17..170 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:25:35 Download gff for BS32262.complete
Subject Subject Range Query Range Percent Splice Strand
X 2322125..2322264 17..156 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:25:35 Download gff for BS32262.complete
Subject Subject Range Query Range Percent Splice Strand
X 2322125..2322264 17..156 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:02:50 Download gff for BS32262.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2216158..2216297 17..156 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:02:50 Download gff for BS32262.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2216158..2216297 17..156 100   Minus

BS32262.pep Sequence

Translation from 16 to 171

> BS32262.pep
MGVATKIFRSHVQGSKKAKATATSRSATRRPRTVRYSKDCLCGMLCKNKY
A*
Sequence BS32262.pep has no blast hits.