Clone BS32342 Report

Search the DGRC for BS32342

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:323
Well:42
Vector:pDNR-Dual
Associated Gene/TranscriptCG31820-RA
Protein status:BS32342.pep: full length peptide match
Sequenced Size:221

Clone Sequence Records

BS32342.complete Sequence

221 bp assembled on 2013-05-22

> BS32342.complete
GAAGTTATCAGTCGACATGTGTTGCCAAGGAGCCTGTGGATCGGTATCCT
ATGCCCTGGCTTATGGCCCCGTCGGACCCGCTCTGCCAGCCATGAACTAC
AATAACTGCTGCTGTGGACCCAATCCTCCCTGTGGTCCCTGGACATGTCC
TCCTAACAGGTGCTGTTGCGCCGGCGAATGGGGTTGCTTTGGGCCTTTTT
ACTGAAAGCTTTCTAGACCAT

BS32342.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:39:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG31820-RB 189 CG31820-PB 1..189 17..205 900 98.4 Plus
CG31820-RA 189 CG31820-PA 1..189 17..205 900 98.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:39:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG31820-RB 419 CG31820-RB 114..302 17..205 900 98.4 Plus
CG31820-RA 440 CG31820-RA 135..323 17..205 900 98.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:39:05
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16005906..16006094 205..17 900 98.4 Minus
Blast to na_te.dros performed on 2014-11-28 13:39:06 has no hits.

BS32342.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-05-22 09:59:44 Download gff for BS32342.complete
Subject Subject Range Query Range Percent Splice Strand
CG31820-RA 135..322 17..204 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:11:09 Download gff for BS32342.complete
Subject Subject Range Query Range Percent Splice Strand
CG31820-RA 135..322 17..204 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:32:01 Download gff for BS32342.complete
Subject Subject Range Query Range Percent Splice Strand
CG31820-RA 135..322 17..204 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:32:01 Download gff for BS32342.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16005907..16006094 17..204 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:11:09 Download gff for BS32342.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16005907..16006094 17..204 98   Minus

BS32342.pep Sequence

Translation from 16 to 204

> BS32342.pep
MCCQGACGSVSYALAYGPVGPALPAMNYNNCCCGPNPPCGPWTCPPNRCC
CAGEWGCFGPFY*

BS32342.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:18:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG31820-PB 62 CG31820-PB 1..62 1..62 402 100 Plus
CG31820-PA 62 CG31820-PA 1..62 1..62 402 100 Plus
CG34167-PA 127 CG34167-PA 66..127 2..62 150 48.4 Plus