Clone BS32344 Report

Search the DGRC for BS32344

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:323
Well:44
Vector:pDNR-Dual
Associated Gene/TranscriptCG43059-RA
Protein status:BS32344.pep: full length peptide match
Sequenced Size:266

Clone Sequence Records

BS32344.complete Sequence

266 bp assembled on 2013-05-22

> BS32344.complete
GAAGTTATCAGTCGACATGATTTGCGTATCACGTCTGGTCATCATCAATT
TGCCCAGTGTCTGGTCATCCAAGAGATCCAAAGACTCGGAGGAAAAGGAT
AGCAAAGATTCTGTAAAGCCAGCTGCACCCAGGGATTTTCAGAGACCTTT
GCAGATCCACACAAAAAGGGGCTACATCAAGTGGTTCAACAAGCTGAGTC
GCTGCCACAAAACTCGTCATTTTTCAGGCAGAATGCATCCCAGGCTGTAG
AAGCTTTCTAGACCAT

BS32344.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:40:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG43059-RA 234 CG43059-PA 1..234 17..250 1155 99.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:40:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG43059-RA 377 CG43059-RA 99..334 17..252 1165 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:40:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8318585..8318731 252..106 720 99.3 Minus
3L 28110227 3L 8318778..8318868 107..17 455 100 Minus
Blast to na_te.dros performed on 2014-11-28 13:40:05 has no hits.

BS32344.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-05-22 10:00:04 Download gff for BS32344.complete
Subject Subject Range Query Range Percent Splice Strand
CG43059-RA 99..332 17..250 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:11:37 Download gff for BS32344.complete
Subject Subject Range Query Range Percent Splice Strand
CG43059-RA 99..332 17..250 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:32:24 Download gff for BS32344.complete
Subject Subject Range Query Range Percent Splice Strand
CG43059-RA 99..332 17..250 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:32:24 Download gff for BS32344.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8318587..8318729 108..250 99 <- Minus
3L 8318778..8318868 17..107 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:11:37 Download gff for BS32344.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8311687..8311829 108..250 99 <- Minus
arm_3L 8311878..8311968 17..107 100   Minus

BS32344.pep Sequence

Translation from 16 to 249

> BS32344.pep
MICVSRLVIINLPSVWSSKRSKDSEEKDSKDSVKPAAPRDFQRPLQIHTK
RGYIKWFNKLSRCHKTRHFSGRMHPRL*

BS32344.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:18:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG43059-PA 77 CG43059-PA 1..77 1..77 414 100 Plus