BS32344.complete Sequence
266 bp assembled on 2013-05-22
> BS32344.complete
GAAGTTATCAGTCGACATGATTTGCGTATCACGTCTGGTCATCATCAATT
TGCCCAGTGTCTGGTCATCCAAGAGATCCAAAGACTCGGAGGAAAAGGAT
AGCAAAGATTCTGTAAAGCCAGCTGCACCCAGGGATTTTCAGAGACCTTT
GCAGATCCACACAAAAAGGGGCTACATCAAGTGGTTCAACAAGCTGAGTC
GCTGCCACAAAACTCGTCATTTTTCAGGCAGAATGCATCCCAGGCTGTAG
AAGCTTTCTAGACCAT
BS32344.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:40:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43059-RA | 234 | CG43059-PA | 1..234 | 17..250 | 1155 | 99.6 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:40:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43059-RA | 377 | CG43059-RA | 99..334 | 17..252 | 1165 | 99.6 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:40:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 8318585..8318731 | 252..106 | 720 | 99.3 | Minus |
3L | 28110227 | 3L | 8318778..8318868 | 107..17 | 455 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 13:40:05 has no hits.
BS32344.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-05-22 10:00:04 Download gff for
BS32344.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43059-RA | 99..332 | 17..250 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:11:37 Download gff for
BS32344.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43059-RA | 99..332 | 17..250 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:32:24 Download gff for
BS32344.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43059-RA | 99..332 | 17..250 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:32:24 Download gff for
BS32344.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 8318587..8318729 | 108..250 | 99 | <- | Minus |
3L | 8318778..8318868 | 17..107 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:11:37 Download gff for
BS32344.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 8311687..8311829 | 108..250 | 99 | <- | Minus |
arm_3L | 8311878..8311968 | 17..107 | 100 | | Minus |
BS32344.pep Sequence
Translation from 16 to 249
> BS32344.pep
MICVSRLVIINLPSVWSSKRSKDSEEKDSKDSVKPAAPRDFQRPLQIHTK
RGYIKWFNKLSRCHKTRHFSGRMHPRL*
BS32344.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:18:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43059-PA | 77 | CG43059-PA | 1..77 | 1..77 | 414 | 100 | Plus |